biological source
mouse
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
6E10, monoclonal
form
buffered aqueous solution
species reactivity
mouse
technique(s)
capture ELISA: suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
Gene Information
human ... AKT3(10000)
General description
The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. (provided by RefSeq)
Immunogen
AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Biochem/physiol Actions
AKT serine/threonine kinase 3 (AKT3) has a role in DNA repair and brain development. In mouse model, it modulates the expression of estrogen receptor α, Erb-B2 receptor tyrosine kinase 2 and Erb-B2 receptor tyrosine kinase 3 in breast cancer cells. AKT3 has been shown to stimulate the growth of triple-negative breast cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
12 - Non Combustible Liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.
O'Hurley G
Histopathology, 64(5), 66-70 (2014)
Targeting Akt3 signaling in triple-negative breast cancer.
Chin YR
Cancer Research, 74(3), 964-973 (2014)
AKT3 regulates ErbB2, ErbB3 and estrogen receptor a expression and contributes to endocrine therapy resistance of ErbB2(+) breast tumor cells from Balb-neuT mice.
Grabinski N
Cellular Signalling, 26(5), 1021-1029 (2014)