Skip to Content
Merck
CN

WH0010000M2

Monoclonal Anti-AKT3 antibody produced in mouse

clone 6E10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZP434N0250, Anti-PKBG, Anti-PRKBG, Anti-RAC-γ, Anti-RACPK-γ, Anti-STK2, Anti-v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6E10, monoclonal

form

buffered aqueous solution

species reactivity

mouse

technique(s)

capture ELISA: suitable, indirect ELISA: suitable, indirect immunofluorescence: suitable, western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

Gene Information

human ... AKT3(10000)

General description

The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. (provided by RefSeq)

Immunogen

AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE

Biochem/physiol Actions

AKT serine/threonine kinase 3 (AKT3) has a role in DNA repair and brain development. In mouse model, it modulates the expression of estrogen receptor α, Erb-B2 receptor tyrosine kinase 2 and Erb-B2 receptor tyrosine kinase 3 in breast cancer cells. AKT3 has been shown to stimulate the growth of triple-negative breast cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

12 - Non Combustible Liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Investigation of molecular alterations of AKT-3 in triple-negative breast cancer.
O'Hurley G
Histopathology, 64(5), 66-70 (2014)
Targeting Akt3 signaling in triple-negative breast cancer.
Chin YR
Cancer Research, 74(3), 964-973 (2014)
AKT3 regulates ErbB2, ErbB3 and estrogen receptor a expression and contributes to endocrine therapy resistance of ErbB2(+) breast tumor cells from Balb-neuT mice.
Grabinski N
Cellular Signalling, 26(5), 1021-1029 (2014)