Skip to Content
Merck
CN

WH0221037M3

Monoclonal Anti-JMJD1C antibody produced in mouse

clone 5F12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-DKFZp761F0118, Anti-FLJ14374, Anti-KIAA1380, Anti-RP1110C13.2, Anti-TRIP8, Anti-jumonji domain containing 1C

Sign In to View Organizational & Contract Pricing

Select a Size

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Key Documents

View All Documentation
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

Quality Level

100

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

5F12, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

NM_004241

UniProt accession no.

Q15652

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... JMJD1C(221037)

General description

Jumonji domain containing 1C (JMJD1C) belongs to the lysine demethylase 3 family and maybe a histone demethylase. The gene encoding it is localized on human chromosome 10q21.3.

Immunogen

JMJD1C (NP_004232, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSD

Biochem/physiol Actions

Jumonji domain containing 1C (JMJD1C) takes part in DNA-damage repair. It is a coactivator of the androgen receptor and also associates with the thyroid receptor. JMJD1C activates a transcription factor involved in acute myeloid leukemia. It has been linked to fatty liver disease and thyroiditis.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

nwg

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number
09013-5F12
06265-5F12

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mo Chen et al.
Genes & development, 29(20), 2123-2139 (2015-10-24)
RUNX1-RUNX1T1 (formerly AML1-ETO), a transcription factor generated by the t(8;21) translocation in acute myeloid leukemia (AML), dictates a leukemic program by increasing self-renewal and inhibiting differentiation. Here we demonstrate that the histone demethylase JMJD1C functions as a coactivator for RUNX1-RUNX1T1
Seung Hoan Choi et al.
PLoS genetics, 12(2), e1005874-e1005874 (2016-02-26)
Vascular endothelial growth factor (VEGF) is an angiogenic and neurotrophic factor, secreted by endothelial cells, known to impact various physiological and disease processes from cancer to cardiovascular disease and to be pharmacologically modifiable. We sought to identify novel loci associated
Rajkumar Dorajoo et al.
Genes & nutrition, 10(6), 53-53 (2015-11-21)
Polyunsaturated fatty acids (PUFAs) have a major impact on human health. Recent genome-wide association studies (GWAS) have identified several genetic loci that are associated with plasma levels of n-3 and n-6 PUFAs in primarily subjects of European ancestry. However, the
Daniela Kurfurstova et al.
Molecular oncology, 10(6), 879-894 (2016-03-19)
The DNA damage checkpoints provide an anti-cancer barrier in diverse tumour types, however this concept has remained unexplored in prostate cancer (CaP). Furthermore, targeting DNA repair defects by PARP1 inhibitors (PARPi) as a cancer treatment strategy is emerging yet requires
Nan Zhu et al.
The Journal of clinical investigation, 126(3), 997-1011 (2016-02-16)
Self-renewal is a hallmark of both hematopoietic stem cells (HSCs) and leukemia stem cells (LSCs); therefore, the identification of mechanisms that are required for LSC, but not HSC, function could provide therapeutic opportunities that are more effective and less toxic

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service