CN
Search Within
840455P
应用筛选条件
关键词:'840455P'
显示 1-30 共 34 条结果 关于 "840455P" 范围 论文
Carola Hofmann et al.
Analytical and bioanalytical chemistry, 412(14), 3383-3393 (2020-04-07)
Liposomes have been widely applied in bioanalytical assays. Most liposomes used bare negative charges to prevent non-specific binding and increase colloidal stability. Here, in contrast, highly stable, positively charged liposomes entrapping the fluorescent dye sulforhodamine B (SRB) were developed to
Interaction of imidazolium-based lipids with phospholipid bilayer membranes of different complexity.
Steffen Bornemann et al.
Physical chemistry chemical physics : PCCP, 22(17), 9775-9788 (2020-04-28)
In recent years, alkylated imidazolium salts have been shown to affect lipid membranes and exhibit general cytotoxicity as well as significant anti-tumor activity. Here, we examined the interactions of a sterically demanding, biophysically unexplored imidazolium salt, 1,3-bis(2,6-diisopropylphenyl)-4,5-diundecylimidazolium bromide (C11IPr), on
Tomoya Taniguchi et al.
Biotechnology and bioengineering, 117(8), 2469-2478 (2020-05-13)
To facilitate the early diagnosis of Alzheimer's disease and mild cognitive impairment patients, we developed a cantilever-based microsensor that immobilized liposomes of various phospholipids to detect a trace amount of amyloid β (Aβ) protein, and investigated its aggregation and fibrillization
Lu Lai et al.
Langmuir : the ACS journal of surfaces and colloids, 33(9), 2378-2386 (2017-02-10)
The inhibitory effects of CdTe/ZnS quantum dots (QDs) modified with 3-mercaptopropionic acid (negatively charged) or cysteamine (positively charged) on the metabolic activity of Escherichia coli were investigated using biological microcalorimetry. Results show that the inhibitory ratio of positive QDs is
Uyen P N Dao et al.
Pharmaceutical research, 37(3), 53-53 (2020-02-12)
The purpose of this study was to inspect the interactions between an anti-breast cancer, TAM, with model of lipid membranes composed of either zwitterionic DPPC LUVs or anionic DPPG LUVs and how they depend on ionic strength and cholesterol. The
Wenting Wang et al.
The journal of physical chemistry. B, 124(25), 5169-5176 (2020-05-27)
Membrane fusion of the viral and host cell membranes is the initial step of virus infection and is catalyzed by fusion peptides. Although the β-sheet structure of fusion peptides has been proposed to be the most important fusion-active conformation, it
Yixing Chen et al.
Langmuir : the ACS journal of surfaces and colloids, 34(3), 1042-1050 (2017-10-12)
The molecular structure of zwitterionic and charged monolayers on small oil droplets in aqueous solutions is determined using a combined second harmonic and sum frequency study. From the interfacial vibrational signature of the acyl chains and phosphate headgroups as well
Thais A Enoki et al.
Langmuir : the ACS journal of surfaces and colloids, 34(5), 2014-2025 (2017-12-29)
Considering the known different mode of action of antimicrobial peptides in zwitterionic and anionic cell membranes, the present work compares the action of the antimicrobial peptide K0-W6-Hya1 (KIFGAIWPLALGALKNLIK-NH2) with zwitterionic and negatively charged model membranes, namely, liposomes composed of phosphatidylcholine
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Cornelia A Hermann et al.
Analytical and bioanalytical chemistry (2020-02-20)
Magnetized liposome (magnetosomes) labels can overcome diffusion limitations in bioassays through fast and easy magnetic attraction. Our aim therefore was to advance the understanding of factors influencing their synthesis focusing on encapsulation strategies and synthesis parameters. Magnetosome synthesis is governed
Bishoy Khairalla et al.
Bioelectrochemistry (Amsterdam, Netherlands), 132, 107443-107443 (2019-12-24)
Planar asymmetric lipid bilayers composed of phosphatidylethanolamine and phosphatidylglycerol lipids are transferred onto a gold electrode surface. Lipids containing two saturated, one monounsaturated and two monounsaturated hydrocarbon chains compose the model membranes. Results of electrochemically controlled polarization modulation infrared reflection
Jiahui Zhang et al.
Langmuir : the ACS journal of surfaces and colloids, 36(6), 1530-1537 (2020-01-30)
The misfolding and aggregation of human islet amyloid polypeptide (hIAPP) at cell membrane has a close relationship with the development of type 2 diabetes (T2DM). This aggregation process is susceptible to various physiologically related factors, and systematic studies on condition-mediated
Eric Oropeza-Guzman et al.
Langmuir : the ACS journal of surfaces and colloids, 34(23), 6869-6873 (2018-05-22)
An environmentally friendly and straightforward dehydration/rehydration method for glycerophospholipid mixing that avoids the use of organic solvents, cosolvents, or additives was developed. We prepared binary mixtures of zwitterionic and anionic glycerophospholipids using only deionized water in the entire mixing process.
Ellen C Wrobel et al.
Physical chemistry chemical physics : PCCP, 22(11), 6154-6166 (2020-03-04)
The antibacterial activity of a calixarene derivative, p-tert-butylcalix[6]arene (Calix6), was assessed and was shown not to inhibit the growth of E. coli, S. aureus and B. subtilis bacteria. With the aim of gaining more insights into the absence of antibacterial
Ridwan P Putra et al.
Langmuir : the ACS journal of surfaces and colloids, 35(50), 16576-16582 (2019-11-26)
Protein-encapsulated nanoclusters (NCs) are emerging as a versatile platform for in-vivo imaging and other biomedical applications due to their ultrasmall size and excitation in the near-infrared region. Encapsulation may however affect protein structure, size, charge, and its interaction with lipid
Membrane Structure and Dynamics
Cell Biology, 227-239 (2017)
Rafael de Oliveira Pedro et al.
Colloids and surfaces. B, Biointerfaces, 192, 111048-111048 (2020-05-04)
The interaction of chitosan, a natural biopolymer with various biomedical applications, with lipid Langmuir films has been widely investigated as a simple model for cell membranes. However, to ensure polymer solubility, up to now only acidic subphases with pH significantly
Emily R Schenk et al.
Journal of mass spectrometry : JMS, 50(1), 88-94 (2015-01-21)
Bacterial resistance to antibiotics has become an increasing threat, requiring not only the development of new targets in drug discovery, but more importantly, a better understanding of cellular response. In the current study, three closely related Escherichia coli strains, a
Ji Wang et al.
Science (New York, N.Y.), 367(6480) (2020-02-23)
Current influenza vaccines only confer protection against homologous viruses. We synthesized pulmonary surfactant (PS)-biomimetic liposomes encapsulating 2',3'-cyclic guanosine monophosphate-adenosine monophosphate (cGAMP), an agonist of the interferon gene inducer STING (stimulator of interferon genes). The adjuvant (PS-GAMP) vigorously augmented influenza vaccine-induced
Joanna Juhaniewicz-Dębińska et al.
Langmuir : the ACS journal of surfaces and colloids, 36(19), 5324-5335 (2020-04-29)
Daptomycin is known as an effective antibiotic lipopeptide which shows activity against the number of Gram-positive pathogens. Its primary target is the bacterial cell membrane. However, the detailed mechanism of daptomycin action is still subject to debate. In this paper
Naomi Benne et al.
Journal of controlled release : official journal of the Controlled Release Society, 318, 246-255 (2019-12-10)
Regulatory T cells (Tregs) are vital for maintaining a balanced immune response and their dysfunction is often associated with auto-immune disorders. We have previously shown that antigen-loaded anionic liposomes composed of phosphatidylcholine (PC) and phosphatidylglycerol (PG) and cholesterol can induce
Qiuhong Yu et al.
Langmuir : the ACS journal of surfaces and colloids, 34(21), 6183-6193 (2018-05-08)
Protein-mediated endocytosis of membrane is a key event in biological system. The mechanism, however, is still not clear. Using a de novo designed bola-type peptide KKKLLLLLLLLKKK (K3L8K3) as a protein mimic, we studied how it induced giant unilamellar vesicle (GUV)
Changes in lipid distribution in E. coli strains in response to norfloxacin
Schenk ER, et al.
Journal of Mass Spectrometry : Jms, 50(1), 88-94 (2015)
Xinjie Song et al.
Mikrochimica acta, 186(12), 834-834 (2019-11-24)
A fluorometric immunoassay is described for the determination of patulin, a highly toxic fungal metabolite. A rabbit anti-patulin-bovine serum albumin (BSA) IgG conjugate was prepared and used to compose immunoliposomes and immunomagnetic nanoparticles. The immunomagnetic nanoparticles are then added to
Drew Marquardt et al.
Langmuir : the ACS journal of surfaces and colloids, 33(15), 3731-3741 (2017-01-21)
We measured the transbilayer diffusion of 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC) in large unilamellar vesicles, in both the gel (Lβ') and fluid (Lα) phases. The choline resonance of headgroup-protiated DPPC exchanged into the outer leaflet of headgroup-deuterated DPPC-d13 vesicles was monitored using 1H
S Blazaki et al.
International journal of pharmaceutics, 576, 118987-118987 (2019-12-25)
A novel Liposome Aggregate Platform (LAP) system for prolonged retention of drugs in the posterior eye segment after intravitreal injection (IVT) was developed and evaluated. Calcein, FITC-dextran-4000 (FD4) and Flurbiprofen (FLB), were encapsulated in negatively charged liposomes, and mixed with
Baixiong Zhang et al.
Langmuir : the ACS journal of surfaces and colloids, 34(25), 7554-7560 (2018-05-29)
The balance of lipid-peptide and peptide-peptide interactions at cell membrane is essential to a large variety of cellular processes. In this study, we have experimentally demonstrated for the first time that sum frequency generation vibrational spectroscopy can be used to
Lipids
Medical Biochemistry, 99-119 (2017)
Aishik Chakraborty et al.
Molecules (Basel, Switzerland), 25(3) (2020-02-13)
Understanding interactions between inhaled nanoparticles and lung surfactants (LS) present at the air-water interface in the lung, is critical to assessing the toxicity of these nanoparticles. Specifically, in this work, we assess the impact of engineered carbon nanoparticles (ECN) on
Carolina Medina Amado et al.
Biochimica et biophysica acta. Biomembranes, 1862(2), 183135-183135 (2019-11-19)
The mechanism of action of the anti-Listeria peptide enterocin CRL35 was studied with biophysical tools by using lipid mixtures that mimicked Gram-positive plasma membranes. Langmuir monolayers and infrared spectroscopy indicated that the peptide readily interacted with phospholipid assembled in monolayers
1/2