Skip to Content
Merck
CN

HPA005700

Anti-MAPK3/ERK1 Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

Synonym(s):

Anti-ERK-1 antibody produced in rabbit, Anti-ERT2 antibody produced in rabbit, Anti-Extracellular signal-regulated kinase 1 antibody produced in rabbit, Anti-Insulin-stimulated MAP2 kinase antibody produced in rabbit, Anti-MAP kinase 1 antibody produced in rabbit, Anti-MAPK 1 antibody produced in rabbit, Anti-Microtubule-associated protein 2 kinase antibody produced in rabbit, Anti-Mitogen-activated protein kinase 3 antibody produced in rabbit, Anti-p44-ERK1 antibody produced in rabbit, Anti-p44-MAPK antibody produced in rabbit

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
MDL number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
2
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-MAPK3 antibody produced in rabbit, Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... MAPK3(5595)

Looking for similar products? Visit Product Comparison Guide

General description

Mitogen-activated protein kinase 3 (MAPK3) is a member of the MAP kinase family and is involved in various cell signalling pathways.

Immunogen

Mitogen-activated protein kinase 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Mitogen-activated protein kinase 3 (MAPK3) is involved actively in signaling modules through which cells transduce extracellular signals into intracellular responses. The different pathways have been associated with the regulation of cellular proliferation, differentiation, angiogenesis, embryo development and tumor invasion. In the Ras/extracellular signal-regulated kinase (ERK) pathway, the p90 ribosomal S6 kinases (RSKs) lie at the terminus of the ERK pathway. RSK activation by ERK requires its interaction through a docking site located near the C terminus of RSK. They form a complex which is further involved in activating and recruiting other proteins downstream for the pathway. In another pathway dealing with cell proliferation and differentiation, Raf phosphorylates and activates MEK1/2, which phosphorylates MAPK3 on Thr183 and Tyr185 in the activation loop resulting in full activation of MAPK3. Phosphorylation and de-phosphorylation of MAPK3 provides a rapid and reversible regulatory system to control its activity.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST86538

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zhimin Lu et al.
Molecular cell, 9(5), 945-956 (2002-06-07)
ERK1/2 MAP kinases are important regulators in cellular signaling, whose activity is normally reversibly regulated by threonine-tyrosine phosphorylation. In contrast, we have found that stress-induced ERK1/2 activity is downregulated by ubiquitin/proteasome-mediated degradation of ERK1/2. The PHD domain of MEKK1, a
Philippe P Roux et al.
Molecular and cellular biology, 23(14), 4796-4804 (2003-07-02)
Stimulation of the Ras/extracellular signal-regulated kinase (ERK) pathway can modulate cell growth, proliferation, survival, and motility. The p90 ribosomal S6 kinases (RSKs) comprise a family of serine/threonine kinases that lie at the terminus of the ERK pathway. Efficient RSK activation

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service