Skip to Content
Merck
CN

HPA018403

Sigma-Aldrich

Anti-RBM8A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-BOV-1, Anti-Binder of OVCA1- 1, Anti-RNA-binding motif protein 8A, Anti-RNA-binding protein 8A, Anti-RNA-binding protein Y14, Anti-Ribonucleoprotein RBM8A

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RBM8A(9939)

General description

The gene RBM8A (RNA-binding motif protein 8A) is mapped to human chromosome 1q21.1. It belongs to a conserved RNA-binding motif protein family. RBM8A is ubiquitously expressed in human tissues. The protein shuttles between the nucleus and the cytoplasm. The protein is popularly known as Y14.

Immunogen

RNA-binding protein 8A recombinant protein epitope signature tag (PrEST)

Application

Anti-RBM8A antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

RNA-binding motif protein 8A (RBM8A) is an RNA binding protein. It is part of the exon-exon junction complex (EJC), which is present on the exon-exon junctions of spliced mRNAs. RBM8A interacts with UPF3B (up-frameshift suppressor-3 homolog B) and together they are essential for nonsense-mediated mRNA decay. RBM8A also controls the alternative splicing of apoptotic regulators. Absence of RBM8A increase production of proapoptotic Bcl-x(S) splice variant. Apart from being an exon junction complex protein, RBM8A associates with receptor-interacting protein-1 (RIP1) and TNFR (tumor necrosis factor receptor)-associated death domain, and positively regulates TNF-α-induced IL (Interleukin)-6 expression in HeLa cells. RBM8A interacts directly with decapping factor DCP2 and the 5′ cap structure of mRNAs, and inhibits the mRNA-decapping activity of DCP2. RBM8A interacts with STAT3 (signal transducer and activator of transcription-3) and regulates its activation by influencing the IL-6-induced tyrosine-phosphorylation of STAT3.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73962

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Josée Dostie et al.
Current biology : CB, 12(13), 1060-1067 (2002-07-18)
Y14 is an RNA binding protein which is part of a multiprotein complex, the exon-exon junction complex (EJC), that assembles on the exon-exon junctions of mRNAs produced by splicing. The position-specific binding of Y14 persists on mRNAs after their export
Sumihito Togi et al.
Journal of immunology (Baltimore, Md. : 1950), 191(3), 1436-1444 (2013-07-03)
Although Y14 is known to be a component of the exon junction complex, we previously reported that Y14 regulates IL-6-induced STAT3 activation. In this study, we showed that endogenous Y14 positively regulated TNF-α-induced IL-6 expression in HeLa cells. Small interfering
Laetitia Michelle et al.
Molecular and cellular biology, 32(5), 954-967 (2011-12-29)
Several apoptotic regulators, including Bcl-x, are alternatively spliced to produce isoforms with opposite functions. We have used an RNA interference strategy to map the regulatory landscape controlling the expression of the Bcl-x splice variants in human cells. Depleting proteins known
Norihiko Ohbayashi et al.
Biochemical and biophysical research communications, 372(3), 475-479 (2008-05-28)
Signal transducer and activator of transcription 3 (STAT3), which mediates biological actions in many physiological processes, is activated by cytokines and growth factors via specific tyrosine-phosphorylation, dimerization, and nuclear translocation. To clarify the molecular mechanisms underlying the regulation of STAT3
X F Zhao et al.
Genomics, 63(1), 145-148 (2000-02-09)
MAGOH is the human homologue of Drosophila mago nashi, a protein that is required for normal germ plasm development in the Drosophila embryo. Using human MAGOH as a bait protein in a yeast two-hybrid screen, we recovered four independent cDNA

Related Content

Prestige Antibodies Immunofluorescence Procedure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service