Skip to Content
Merck
CN

HPA022945

Anti-GGA3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ADP-ribosylation factor-binding protein GGA3, Anti-Golgi-localized, gamma ear-containing, ARF-binding protein 3

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
5
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

LDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHH

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GGA3(23163)

Looking for similar products? Visit Product Comparison Guide

General description

The gene GGA3 (golgi-associated, γ adaptin ear containing, ARF binding proteins) is mapped to human chromosome 17q25.1. The protein contains a GAT (GGA and Tom1) domain and the VHS (Vps27, Hrs, STAM) domain.

Immunogen

ADP-ribosylation factor-binding protein GGA3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

GGAs (golgi-associated, γ adaptin ear containing, ARF binding proteins) are adaptor-related proteins, which interact with ADP-ribosylation factors (ARFs). They are present in the trans-Golgi network (TGN) and form connection between clathrin and membrane-bound ARF-GTP (guanosine triphosphate). GGAs play a crucial role in trafficking between the TGN and endosomes. GGA3 also binds to the subunits of the ubiquitin-dependent sorting machinery. It controls trafficking and degradation of BACE1 (β-site AβPP-cleaving enzyme). BACE1 is important for the generation of amyloid-β in Alzheimer′s disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST75610

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品

This item has


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Teemu Natunen et al.
Journal of Alzheimer's disease : JAD, 37(1), 217-232 (2013-08-24)
Golgi-localized γ-ear-containing ADP-ribosylation factor-binding protein (GGA3) is a central regulator of trafficking and degradation of BACE1 (β-site AβPP-cleaving enzyme), the rate-limiting enzyme in the production of amyloid-β (Aβ) in Alzheimer's disease (AD). Here, we assessed the potential role of GGA3
Vincenzo Sollazzo et al.
Journal of biomedical materials research. Part B, Applied biomaterials, 84(2), 550-558 (2007-07-20)
Zirconium is widely used as material for prosthetic devices because its good mechanical and chemical properties. When exposed to oxygen, zirconium becomes zirconium oxide (ZrO(2)), which is biocompatible. ZrO(2) can be also prepared as a colloidal suspension and then used
Rosa Puertollano et al.
Nature cell biology, 6(3), 244-251 (2004-03-25)
The Golgi-localized, gamma-ear-containing, Arf-binding (GGA) proteins constitute a family of clathrin adaptors that are mainly associated with the trans-Golgi network (TGN) and mediate the sorting of mannose 6-phosphate receptors. This sorting is dependent on the interaction of the VHS domain
Jing Wang et al.
Molecular biology of the cell, 18(7), 2646-2655 (2007-05-15)
Phosphatidylinositol 4 phosphate (PI4P) is highly enriched in the trans-Golgi network (TGN). Here we establish that PI4P is a key regulator of the recruitment of the GGA clathrin adaptor proteins to the TGN and that PI4P has a novel role
R Puertollano et al.
Cell, 105(1), 93-102 (2001-04-13)
The GGAs constitute a family of modular adaptor-related proteins that bind ADP-ribosylation factors (ARFs) and localize to the trans-Golgi network (TGN) via their GAT domains. Here, we show that binding of the GAT domain stabilizes membrane-bound ARF1.GTP due to interference

Global Trade Item Number

SKUGTIN
HPA022945-25UL04061842882625
HPA022945-100UL04061835686049

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service