AV32564
Anti-FOXP1 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Forkhead box P1
Sign In to View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
75 kDa
species reactivity
horse, mouse, human, rabbit, rat, guinea pig
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... FOXP1(27086)
General description
FOXP1 is a transcription regulator that is expressed in B cells. High levels of FOXP1 expression have been associated with poor prognosis in patients with diffuse large B-cell lymphomas (DLBCLs). Chromosomal aberrations in FOXP1 gene have been linked to mucosa-associated lymphoid tissue (MALT) lymphoma.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.
Immunogen
Synthetic peptide directed towards the N terminal region of human FOXP1
Application
Rabbit Anti-FOXP1 antibody can be used for IHC (4-8μg/ml) and western blotting (0.5μg/ml) applications.
Biochem/physiol Actions
FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Sharon L Barrans et al.
Blood, 104(9), 2933-2935 (2004-07-09)
FOXP1 (Forkhead box-P1) is a winged-helix transcription factor that is differentially expressed in resting and activated B cells. FOXP1 expression has been demonstrated in a subset of diffuse large B-cell lymphomas (DLBCLs) and is more common in the nongerminal center
B Streubel et al.
Leukemia, 19(4), 652-658 (2005-02-11)
The three chromosomal translocations t(11;18)(q21;q21), t(14;18)(q32;q21), and t(1;14)(p22;q32) are associated with MALT lymphoma. In a case of MALT lymphoma of the thyroid, we observed t(3;14)(p14.1;q32) by cytogenetic analysis. Fluorescence in situ hybridization studies showed that the immunoglobulin heavy chain locus
Guoxiao Guo et al.
Oncology letters, 12(2), 1554-1558 (2016-07-23)
The aim of the present study was to investigate the expression and function of forkhead box protein 3 (FOXP3) in gastric cancer using a rat model. A total of 92 Wistar rats were divided into two groups: An experimental group
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service