AV34957
Anti-CACNB3 antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-Calcium channel, voltage-dependent, β 3 subunit
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
53 kDa
species reactivity
horse, human, guinea pig, rat, mouse, bovine, rabbit, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CACNB3(784)
Related Categories
General description
Voltage-dependent L-type calcium channel subunit β-3 (CACNB3) is the β subunit critical for proper functioning of the voltage-dependent L-type calcium channel by increasing calcium current. It is a 54 kDa protein shown to be critical for renal and cardiac cell functioning as well as the survival of CD8+ T lymphocytes.
Immunogen
Synthetic peptide directed towards the C terminal region of human CACNB3
Biochem/physiol Actions
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Henry M Colecraft et al.
The Journal of physiology, 541(Pt 2), 435-452 (2002-06-04)
Recombinant adenoviruses were used to overexpress green fluorescent protein (GFP)-fused auxiliary Ca(2+) channel beta subunits (beta(1)-beta(4)) in cultured adult rat heart cells, to explore new dimensions of beta subunit functions in vivo. Distinct beta-GFP subunits distributed differentially between the surface
Mithilesh K Jha et al.
Nature immunology, 10(12), 1275-1282 (2009-10-20)
The survival of T lymphocytes requires sustained, Ca(2+) influx-dependent gene expression. The molecular mechanism that governs sustained Ca(2+) influx in naive T lymphocytes is unknown. Here we report an essential role for the beta3 regulatory subunit of voltage-gated calcium (Ca(v))
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service