AV46773
Anti-SC4MOL antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-DESP4, Anti-ERG25, Anti-MGC104344, Anti-Sterol-C4-methyloxidase-like
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
35 kDa
species reactivity
pig, rabbit, dog, human, horse, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SC4MOL(6307)
Related Categories
General description
Sterol-C4-methyloxidase-like/methylsterol monooxygenase 1 (SC4MOL, DESP4, ERG25, MSMO1) is an endoplasmic reticulum enzyme that catalyzes the demethylation of C4-methlysterols (meiosis-activating sterols, MAS) in the cholesterol synthesis pathway. Defective/mutated SC4MOL contributes to psoriasiform dermatitis, microcephaly, and developmental delay.
Immunogen
Synthetic peptide directed towards the N terminal region of human SC4MOL
Application
Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sterol-C4-methyloxidase-like in the management of C4-methlysterols (meiosis-activating sterols, MAS) levels.
Biochem/physiol Actions
Anti-SC4MOL polyclonal antibody reacts with zebrafish, bovine, pig, human, mouse, rat, and canine sterol-C4-methyloxidase-like proteins.
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service