Skip to Content
Merck
CN

AV49710

Anti-POPDC3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MGC22671, Anti-POP3, Anti-Popeye domain containing 3, Anti-bA355M14.1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
4
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

34 kDa

species reactivity

dog, rat, bovine, guinea pig, rabbit, human, horse, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Quality Level

Gene Information

human ... POPDC3(64208)

Looking for similar products? Visit Product Comparison Guide

Related Categories

General description

The gene Popeye domain containing 3 (POPDC3; POP3) is mapped to human chromosome 6q21. POPDC3 is a transmembrane protein expressed in cardiac and skeletal muscles. It belongs to POPDC gene family.

Immunogen

Synthetic peptide directed towards the C terminal region of human POPDC3

Application

Anti-POPDC3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

The expression of Popeye domain containing 3 (POPDC3; POP3) is essential for the development of cardiac and skeletal tissues during the development of vertebrates. POPDC3 is identified as a cAMP binding protein. Decrease in the expression of POPDC3 due to promoter hypermethylation correlates with poor prognosis of gastric cancer.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

  1. Which document(s) contains shelf-life or expiration date information for a given product?

    If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.

  2. How do I get lot-specific information or a Certificate of Analysis?

    The lot specific COA document can be found by entering the lot number above under the "Documents" section.

  3. How do I find price and availability?

    There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote.  USA customers:  1-800-325-3010 or view local office numbers.

  4. What is the Department of Transportation shipping information for this product?

    Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product. 

  5. What is the molecular weight for the POPDC3 protein?

    The POPDC3 protein is a 292 amino acid, 37kiloDalton protein with 3 predicted N-terminal transmembrane domains.  

  6. What is the suggested antibody concentration to use Anti-POPDC3 antibody, Product No. AV49710, for Western Blot applications?

    The recommended starting dilution for this antibody in Western Blot applications is 1 microgram/ml in 5% skim milk/PBS buffer.  The end user will need to titrate the concentration according to their application.

  7. How do I reconstitute  Anti-POPDC3 antibody, Product No. AV49710?

    This antibody is lyophilyzed from PBS buffer with 2% sucrose.  Add 50 microliters of distilled water to get a final antibody concentration of 1mg/ml.  It is best to aliquot the antibody into smaller portions and store at -20 degrees Celsius (avoid multiple freeze/thaws).  

  8. Can the Anti-POPDC3 antibody, Product No. AV49710 be used in applications other than Western Blot?

    This antibody has not been tested in any applications other than Western Blot.  

  9. My question is not addressed here, how can I contact Technical Service for assistance?

    Ask a Scientist here.

Deng Luo et al.
World journal of gastroenterology, 18(19), 2423-2429 (2012-06-02)
To investigate the expression of Popeye domain containing 3 (Popdc3) and its correlation with clinicopathological features and prognosis of gastric cancer. The method of immunohistochemistry was used to investigate the expression of Popdc3 in 306 cases of human gastric cancer
Thomas Brand et al.
Biochemical Society transactions, 42(2), 295-301 (2014-03-22)
Popdc (Popeye-domain-containing) genes encode membrane-bound proteins and are abundantly present in cardiac myocytes and in skeletal muscle fibres. Functional analysis of Popdc1 (Bves) and Popdc2 in mice and of popdc2 in zebrafish revealed an overlapping role for proper electrical conduction
Mirang Kim et al.
Carcinogenesis, 31(9), 1685-1693 (2010-07-16)
The Popeye domain-containing (POPDC) genes BVES, POPDC2 and POPDC3 encode proteins that regulate cell-cell adhesion and cell migration during development. Herein, we report the frequent downregulation of BVES and POPDC3 by promoter hypermethylation in gastric cancer. POPDC expression in 11
B Andrée et al.
Developmental biology, 223(2), 371-382 (2000-07-07)
We identified a novel gene family in vertebrates which is preferentially expressed in developing and adult striated muscle. Three genes of the Popeye (POP) family were detected in human and mouse and two in chicken. Chromosomal mapping indicates that Pop1

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service