Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
7
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
36 kDa
species reactivity
rabbit, dog, horse, rat, human, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Quality Level
Gene Information
human ... LDHC(3948)
Related Categories
General description
LDHC (lactate dehydrogenase C) gene also referred to as LDH3, LDHX or MGC111073 encodes for an enzyme that belongs to the lactate dehydrogenase family.
Immunogen
Synthetic peptide directed towards the middle region of human LDHC
Application
Anti-LDHC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
LDHC is testis-specific and acts as a key enzyme for sperm motility. It facilitates the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. Additionally, it also serves as a diagnostic marker for chronic tuberculosis. 3 LDH works to prevent muscular failure and fatigue in multiple ways.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Regulatory Information
新产品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Tahereh Esmaeilpour et al.
Iranian journal of medical sciences, 39(1), 20-28 (2014-01-24)
Application of follicular fluid (FF) and platelet-activating factor (PAF) in artificial insemination improves sperm motility. Lactate dehydrogenase C (LDH-C) is a key enzyme for sperm motility. In this study, the effects of FF and PAF on the sperm motility index
Fanny Odet et al.
Biology of reproduction, 79(1), 26-34 (2008-03-28)
The lactate dehydrogenase (LDH) protein family members characteristically are distributed in tissue- and cell type-specific patterns and serve as the terminal enzyme of glycolysis, catalyzing reversible oxidation reduction between pyruvate and lactate. They are present as tetramers, and one family
P R Sharma et al.
Clinical biochemistry, 40(18), 1414-1419 (2007-10-16)
The objective of this investigation was to find out if sputum-positive (AFB test) test, which is performed to assess mycobacterial infection status, is anyway correlated with any of the LDH isoforms. And if so, can it be used, either alone
Lin Huang et al.
Animal biotechnology, 23(2), 114-123 (2012-04-28)
The objective of the present study was to confirm the widespread existence of alternative splicing of lactate dehydrogenase c (ldhc) gene in mammals. RT-PCR was employed to amplify cDNAs of ldhc from testes of mammals including pig, dog, rabbit, cat
Fanny Odet et al.
Biology of reproduction, 85(3), 556-564 (2011-05-14)
We demonstrated previously that disruption of the germ cell-specific lactate dehydrogenase C gene (Ldhc) led to male infertility due to defects in sperm function, including a rapid decline in sperm ATP levels, a decrease in progressive motility, and a failure
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service