Skip to Content
Merck
CN

AV53629

Anti-CDKN3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-CDI1, Anti-CIP2, Anti-Cyclin-dependent kinase inhibitor 3 (CDK2-associated dual specificity phosphatase), Anti-FLJ25787, Anti-KAP, Anti-KAP1, Anti-MGC70625

Sign Into View Organizational & Contract Pricing

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

23 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CDKN3(1033)

Related Categories

General description

Cyclin-dependent kinase inhibitor 3 is an enzyme encoded by the CDKN3 gene in humans. CDKN3 (cyclin-dependent kinase inhibitor 3) gene also referred to as CDI1, CIP2, FLJ25787, KAP1, KAP or MGC70625 encodes a protein that belongs to dual specificity protein phosphatase family.

Immunogen

Synthetic peptide directed towards the C terminal region of human CDKN3

Application

Anti-CDKN3 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Biochem/physiol Actions

Cyclin-dependent kinase inhibitor 3 (CDKN3) regulates the mitosis through the CDC2 signaling axis. CDKN3 also possess the capability to interact with multiple cyclin-dependent kinases and hence may facilitate the cell cycle regulation. Increased expression of CDKN3 enhances the kinase-associated phosphatase activity that inhibits the G1/S transition of the cell cycle by dephosphorylating the cyclin dependent kinases. It promotes tumour genesis. It may play an important role in the development and proliferation of epithelial ovarian cancer (EOC).

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Regulatory Information

常规特殊物品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tianren Li et al.
Oncology reports, 31(4), 1825-1831 (2014-02-28)
Cyclin-dependent kinase inhibitor 3 (CDKN3) has been reported to promote tumor genesis. Since it is unclear whether CDKN3 participates in the development of epithelial ovarian cancer (EOC), this study assessed the association between CDKN3 expression and cell biological functions, and
Grzegorz Nalepa et al.
The Journal of cell biology, 201(7), 997-1012 (2013-06-19)
Mitosis is controlled by a network of kinases and phosphatases. We screened a library of small interfering RNAs against a genome-wide set of phosphatases to comprehensively evaluate the role of human phosphatases in mitosis. We found four candidate spindle checkpoint
G J Hannon et al.
Proceedings of the National Academy of Sciences of the United States of America, 91(5), 1731-1735 (1994-03-01)
The cyclin-dependent kinases are key cell cycle regulators whose activation is required for passage from one cell cycle phase to the next. In mammalian cells, CDK2 has been implicated in control of the G1 and S phases. We have used
D J Demetrick et al.
Cytogenetics and cell genetics, 69(3-4), 190-192 (1995-01-01)
Many gene products associated with the cdk cell cycle kinases are thought to regulate the active kinase complex and thus regulate the transition points of the cell cycle. Genes encoding these proteins may potentially function as oncogenes or tumor suppressor
Chau-Ting Yeh et al.
Biochemical and biophysical research communications, 305(2), 311-314 (2003-05-15)
The cyclin-dependent kinase (Cdk)-associated protein phosphatase (KAP) is a human dual-specificity protein phosphatase that dephosphorylates Cdk2 on a conserved threonine residue, T160, in a cyclin dependent manner. Several aberrant KAP transcripts with characteristic deletion regions have been identified in hepatocellular

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service