Skip to Content
Merck
CN

HPA005480

Anti-SYVN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DER3, Anti-HRD1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
9
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... SYVN1(84447)

Looking for similar products? Visit Product Comparison Guide

General description

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) is a part of ER-associated degradation (ERAD) and is an E3 ubiquitin ligase. It localizes to endoplasmic reticulum (ER) and is ubiquitously expressed. It is highly expressed in skeletal muscle, pancreas and liver. SYVN1 contains six domains, which span the plasma membrane. It is a non-glycosylated protein and has a cytoplasmic RING-H2 finger domain. This gene is located on chromosome 11q13.

Immunogen

E3 ubiquitin-protein ligase synoviolin precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-SYVN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Synovial apoptosis inhibitor 1/ synoviolin (SYVN1) plays a key role in various processes, such as embryogenesis or negative regulation of tumor suppressor gene p53. The expression of SYVN1 is induced by IRE1 and ATF6, during ER stress, where it protects against ER-stress induced cell apoptosis. It is a part of endoplasmic reticulum associated degradation (ERAD) and degrades 3-hydroxy-3-methylglutaryl-coenzyme A, along with TCR-α and CD3-δ, which are ERAD substrates. It also sequesters p53, in the cytoplasm, and ubiquitinates it. Thus, it represses the various activities of p53, such as cell cycle regulation and apoptosis. SYVN1 is responsible for maintaining joint homeostasis and hence, is involved in the pathogenesis of arthropathy. In rheumatoid arthritis, it is overexpressed in synovial cells, leading to a ′hyper-ERAD′ state. It interacts with, and degrades tau and phosphorylated tau (p-tau). Therefore, it prevents tau-induced cytotoxicity and helps neuronal survival.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70751

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Y X Shen et al.
Current molecular medicine, 12(2), 138-152 (2012-01-28)
Intraneuronal accumulation of abnormal phosphorylated tau (p-tau) is a molecular pathology in many neurodegenerative tauopathies, including Alzheimer's disease (AD) and frontotemporal dementia with parkinsonism-linked to chromosome 17 (FTDP-17). However, the underlying mechanism remains unclear. Here, we showed an inverse relationship
Amanda Crider et al.
Molecular autism, 5, 45-45 (2014-11-14)
Although the neurobiological basis of autism spectrum disorder (ASD) is not fully understood, recent studies have indicated the potential role of GABAA receptors in the pathophysiology of ASD. GABAA receptors play a crucial role in various neurodevelopmental processes and adult
Keisuke Yamamoto et al.
Journal of biochemistry, 144(4), 477-486 (2008-07-31)
Quality control of proteins in the endoplasmic reticulum (ER) is achieved by two mechanisms, the productive folding mechanism, which is assisted by a number of ER-localized molecular chaperones and folding enzymes (collectively termed ER chaperones), and the ER-associated degradation (ERAD)
Marjolein Kikkert et al.
The Journal of biological chemistry, 279(5), 3525-3534 (2003-11-01)
The ubiquitin system plays an important role in endoplasmic reticulum (ER)-associated degradation of proteins that are misfolded, that fail to associate with their oligomerization partners, or whose levels are metabolically regulated. E3 ubiquitin ligases are key enzymes in the ubiquitination
Naoko Yagishita et al.
Nature clinical practice. Rheumatology, 4(2), 91-97 (2008-02-01)
Rheumatoid arthritis is a disease associated with painful joints that affects approximately 1% of the population worldwide, and for which no specific cure is available. Among other functions, the endoplasmic reticulum (ER) has an important role in protein folding. When

Related Content

Prestige Antibodies Immunofluorescence Procedure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service