Skip to Content
Merck
CN

HPA014837

Anti-HACD3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-B-ind1, Anti-HSPC121, Anti-PTPLAD1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
4
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAKEEERLNKLRLE

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... PTPLAD1(51495)

Looking for similar products? Visit Product Comparison Guide

General description

HACD3 (3-hydroxyacyl-CoA dehydratase 3) is a multi-pass membrane protein, which shares high homology with p23, a co-chaperone. This protein is composed of 362 amino acids. This gene is localized to human chromosome 15q22.3. It was originally identified as a gene activated by sodium butyrate. It has a molecular weight of 70.6kDa, and the mRNA is highly expressed in brain, kidney, and liver, and has low expression in skeletal muscle. The protein is ubiquitously expressed.

Immunogen

3-hydroxyacyl-CoA dehydratase 3

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

HACD3 (3-hydroxyacyl-CoA dehydratase 3) controls gene expression through Rac-1 signaling pathway. It is involved in the replication of hepatitis C virus (HCV), by interacting with HCV nonstructural protein 5A (NS5A), and recruiting heat shock protein 90 (Hsp90) and FK506-binding protein 8 (FKBP8) to the replication complex. This protein is involved in erythropoiesis, in bone marrow, and activation of NF-κB and c-Jun N-terminal kinase, via Rac-1 pathway. It might be involved in the synthesis of very long chain fatty acids, by interacting with ELOVL1, ELOVL5, or ELOVL6.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73204

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品
低风险生物材料
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Shuhei Taguwa et al.
Journal of virology, 83(20), 10427-10436 (2009-08-07)
Hepatitis C virus (HCV) nonstructural protein 5A (NS5A) is a component of the replication complex consisting of several host and viral proteins. We have previously reported that human butyrate-induced transcript 1 (hB-ind1) recruits heat shock protein 90 (Hsp90) and FK506-binding
Michèle Sabbah et al.
Gene, 374, 128-133 (2006-03-07)
Histone deacetylase inhibitors (HDIs) induced expression of the B-ind1 protein that is a component of Rac-1-signaling pathways leading to the modulation of gene expression. In the present study, we have determined the structure of the human B-ind1 gene promoter region.
Mika Ikeda et al.
FEBS letters, 582(16), 2435-2440 (2008-06-17)
Very long-chain fatty acids are produced through a four-step cycle. However, the 3-hydroxyacyl-CoA dehydratase catalyzing the third step in mammals has remained unidentified. Mammals have four candidates, HACD1-4, based on sequence similarities to the recently identified yeast Phs1, although HACD3
Keyue Ding et al.
Mayo Clinic proceedings, 87(5), 461-474 (2012-05-09)
To identify common genetic variants influencing red blood cell (RBC) traits. We performed a genomewide association study from June 2008 through July 2011 of hemoglobin, hematocrit, RBC count, mean corpuscular volume, mean corpuscular hemoglobin, and mean corpuscular hemoglobin concentration in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service