Skip to Content
Merck
CN

HPA018174

Anti-HHATL antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-GUP1, Anti-Glycerol uptake/transporter homolog, Anti-Hedgehog acyltransferase-like protein, Anti-Protein-cysteine N-palmitoyltransferase HHAT-like protein

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:20- 1:50

immunogen sequence

ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HHATL(57467)

General description

The gene HHATL (hedgehog acyltransferase-like protein) is mapped to human chromosome 3p22. HHATL is strongly expressed in heart and skeleton muscle. The protein is localized in the cytoplasm.

Immunogen

Protein-cysteine N-palmitoyltransferase HHAT-like protein recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Hedgehog acyltransferase-like protein (HHATL) is down-regulated in skin squamous cell carcinoma and nasopharyngeal carcinoma. The gene functions as a potential tumor suppressor of nasopharyngeal carcinoma. High expression of HHATL reduces the proliferation, invasion and tumorgenicity in nude mice. HHTL is essential for postnatal skeletal muscle maturation in mice model. HHTL-knockout mice have swelled sarcoplasmic reticulum and presence of enormous vacuoles. Additionally, the unfolded protein response is severely activated in the knockout mice.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72713

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

San-quan Zhang et al.
Di 1 jun yi da xue xue bao = Academic journal of the first medical college of PLA, 25(10), 1216-1220 (2005-10-20)
To establish a 6-10B cell line with stable expression of KIAA1173 gene and study the biological behaviors of the cells. The total RNA was extracted from normal skeletal muscular tissues for cloning of KIAA1173 gene by means of RT-PCR which
San-Quan Zhang et al.
Ai zheng = Aizheng = Chinese journal of cancer, 24(11), 1322-1326 (2006-03-24)
Although the molecular etiology of nasopharyngeal carcinoma (NPC) is still unknown, studies showed that there are NPC-associated tumor suppressor genes residing in chromosome 3p21-22. KIAA1173 gene, locates at 3p22.1, was characterized as a new carcinoma-related gene, while its correlation to
M A MacAulay et al.
Transplantation, 39(5), 490-495 (1985-05-01)
Autotransplants of pancreas in 8 dogs, with exocrine drainage into the urinary bladder, were stimulated in vivo with cholecystokinin-pancreozymin (CCK-PZ). Transplant biopsies, when compared with 6 normal pancreases, showed normal acinar structure by light and electron microscopy 13-18 months after
San-quan Zhang et al.
Zhonghua yi xue za zhi, 90(18), 1243-1246 (2010-07-22)
To clone, prepare probe for and explore the expression levels of KIAA1173 gene in skin squamous cell carcinoma (SSCC) and investigate its expression, clinical and pathological significance. KIAA1173 gene fragment (354 bp) was cloned and its cDNA probe prepared. The
H Soejima et al.
Genomics, 74(1), 115-120 (2001-05-26)
Two novel heart-specific genes, C3orf3 (chromosome 3 open reading frame 3) and MMGL (myomegalin-like), were isolated using BodyMap, a gene expression database based on site-directed 3' expressed sequence tags (3'-ESTs) which were collected from nonbiased cDNA libraries of various tissues.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service