Skip to Content
Merck
CN

HPA018458

Anti-XIRP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-Cardiomyopathy-associated protein 1, Anti-Xin actin-binding repeat-containing protein 1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-XIRP1 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:200-1:500

immunogen sequence

RVSTEVAQLKEQTLARLLDIEEAVHKALSSMSSLQPEASARGHFQGPPKDHSAHKISVTVSSSARPSGSGQEVGGQTAVKNQAKVECHTEAQSQVKIRNHT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... XIRP1(165904)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Down-regulation of xin actin-binding repeat-containing protein-1 (XIRP1) in cultured chicken embryos results in abnormal development of the heart. XIRP1 is up-regulated in injured mouse muscle. The unique amino acid repeats in XIRP1 are responsible for binding and stabilization of actin-based cytoskeleton. XIRP1 interacts with phosphoglucomutase-like protein 5 (PGM5) and filamin C. All three together are present at intercalated discs of cardiac muscle and myotendinous junctions of skeletal muscle. XIRP1 also associates with the EVH1 (Ena/Vasp homology) domain proteins MENA (Protein enabled homolog) and VASP (Vasodilator-stimulated phosphoprotein). In adult heart, XIRP1 and MENA/VASP localizes with filamin C in intercalated discs.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

General description

The gene XIRP1 (xin actin-binding repeat-containing protein-1) is mapped to human chromosome 3p22.2. It belongs to XIRP family. The protein is expressed during early developmental stages of cardiac and skeletal muscles. In adults, XIRP1 is mainly present in the intercalated discs of cardiomyocytes and the myotendinous junctions of skeletal muscle cells. The protein contains unique 16 amino acid repeats. Fluorescent tagging of the protein showed targeting to F-actin containing structures.

Immunogen

Xin actin-binding repeat-containing protein 1 recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST74653

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Regulatory Information

新产品
This item has

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sibylle Molt et al.
Journal of cell science, 127(Pt 16), 3578-3592 (2014-06-26)
Filamin C (FLNc) and Xin actin-binding repeat-containing proteins (XIRPs) are multi-adaptor proteins that are mainly expressed in cardiac and skeletal muscles and which play important roles in the assembly and repair of myofibrils and their attachment to the membrane. We
Beate St Pourcain et al.
Molecular autism, 5(1), 18-18 (2014-02-26)
Social-communication abilities are heritable traits, and their impairments overlap with the autism continuum. To characterise the genetic architecture of social-communication difficulties developmentally and identify genetic links with the autistic dimension, we conducted a genome-wide screen of social-communication problems at multiple
Peter F M van der Ven et al.
Experimental cell research, 312(11), 2154-2167 (2006-04-25)
Filamin c is the predominantly expressed filamin isoform in striated muscles. It is localized in myofibrillar Z-discs, where it binds FATZ and myotilin, and in myotendinous junctions and intercalated discs. Here, we identify Xin, the protein encoded by the human
Dirk Pacholsky et al.
Journal of cell science, 117(Pt 22), 5257-5268 (2004-09-30)
Xin is a protein that is expressed during early developmental stages of cardiac and skeletal muscles. Immunolocalization studies indicated a peripheral localization in embryonic mouse heart, where Xin localizes with beta-catenin and N-cadherin. In adult tissues, Xin is found primarily
Mats I Nilsson et al.
The American journal of pathology, 183(6), 1703-1709 (2013-11-15)
Xin is a striated muscle-specific protein that is localized to the myotendinous junction in skeletal muscle. However, in injured mouse muscle, Xin expression is up-regulated and observed throughout skeletal muscle fibers and within satellite cells. In this study, Xin was

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service