SAB1402084
Monoclonal Anti-SLC13A5 antibody produced in mouse
clone 2G4, purified immunoglobulin, buffered aqueous solution
Synonym(s):
DKFZp686E17257, MGC138356, NACT
Sign Into View Organizational & Contract Pricing
Select a Size
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2G4, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
capture ELISA: suitable
western blot: 1-5 μg/mL
isotype
IgG1κ
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLC13A5(284111)
Related Categories
General description
The solute carrier family 13 member 5 (SLC13A5) gene is mapped to human chromosome 17p13.1. It is highly expressed in the plasma membrane of hepatocytes and is also expressed in the cells of testis and brain.
Immunogen
SLC13A5 (NP_808218, 152 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
Sequence
VEAILQQMEATSAATEAGLELVDKGKAKELPGSQVIFEGPTLGQQEDQERKRLCK
Biochem/physiol Actions
SLC13A5 (solute carrier family 13 member 5) is a sodium-coupled citrate transporter. Its function involves the transportation of citrate from the bloodstream into the liver. The expression of the gene is found to be increased in obesity and non-alcoholic fatty liver disease. Downregulation of SLC13A5 promotes AMPK (adenosine monophosphate-activated protein kinase) activation and inhibits ACLY (ATP citrate lyase) expression. SLC13A5 is thus found to regulate homeostasis of energy and lipid in liver cancer, as the gene is associated with synthesis of fatty acids and cholesterol. Mutation in the SLC13A5 gene leads to early occurrence of epilepsy, developmental delay and tooth dysplasia in children.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Mutations in the Na(+)/citrate cotransporter NaCT (SLC13A5) in pediatric patients with epilepsy and developmental delay.
Klotz J
Molecular Medicine, 22, 1-12 (2016)
Silencing of solute carrier family 13 member 5 disrupts energy homeostasis and inhibits proliferation of human hepatocarcinoma cells.
Li Z
The Journal of Biological Chemistry, 292(33), 13890-13901 (2017)
Flipping a citrate switch on liver cancer cells.
Peters JM
The Journal of Biological Chemistry, 292(33), 13902-13903 (2017)
Epilepsy and mental retardation restricted to females: X-linked epileptic infantile encephalopathy of unusual inheritance.
Duszyc K
Journal of applied genetics, 56(1), 49-56 (2015)
Plasma Membrane xn-Na-zbu-Coupled Citrate Transporter (SLC13A5) and Neonatal Epileptic Encephalopathy
Bhutia YD, et al.
Molecules (Basel), 3-3 (2017)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service