Skip to Content
Merck
CN

WH0004216M2

Monoclonal Anti-MAP3K4 antibody produced in mouse

clone 6C6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-KIAA0213, Anti-MAPKKK4, Anti-MEKK4, Anti-MTK1, Anti-PRO0412, Anti-mitogen-activated protein kinase kinase kinase 4

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Conjugate:
unconjugated
Clone:
6C6, monoclonal
Application:
ELISA (i), IHC (p), WB
Citations:
3
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6C6, monoclonal

form

buffered aqueous solution

species reactivity

mouse

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, indirect ELISA: suitable, western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MAP3K4(4216)

General description

MAP3K4 (mitogen-activated protein kinase kinase kinase 4) gene encodes a component of protein kinase signal transduction cascade. It is also termed as MTK1 (MAP3 kinase 1). MAP3K4 contains a protein kinase catalytic domain at the C terminus and a regulatory/autoinhibitory domain at the N-terminus. It is located on human chromosome 6q26.
The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described. (provided by RefSeq)

Immunogen

MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS

Biochem/physiol Actions

MAP3K4 (mitogen-activated protein kinase kinase kinase 4) phosphorylates and activates a specific MAPK kinase (MAPKK) in the cascade through phosphorylation of conserved threonine and/or serine residues. GADD45 (growth arrest and DNA-damage-inducible proteins) proteins interact with and free the autoinhibitory domain from the kinase domain, thus activating MAP3K4. It mediates the activation of p38 MAPK pathway and the JNK (c-Jun N-terminal kinase) pathway induced by environmental stresses.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Regulatory Information

常规特殊物品

This item has



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



M Takekawa et al.
The EMBO journal, 16(16), 4973-4982 (1997-08-15)
A human homolog of the yeast Ssk2 and Ssk22 mitogen-activated protein kinase kinase kinases (MAPKKK) was cloned by functional complementation of the osmosensitivity of the yeast ssk2delta ssk22delta sho1delta triple mutant. This kinase, termed MTK1 (MAP Three Kinase 1), is
Comparison between osteoblasts derived from human dental pulp stem cells and osteosarcoma cell lines
Palmieri A, et al.
Cell Biology International, 32(7), 733-738 (2008)
Hiroaki Mita et al.
Molecular and cellular biology, 22(13), 4544-4555 (2002-06-08)
A variety of cellular stresses activate the stress-responsive mitogen-activated protein (MAP) kinases p38 and JNK. In this study, we studied the activation mechanism of a human MAP kinase kinase kinase, MTK1 (also known as MEKK4), which mediates activation of both



Global Trade Item Number

SKUGTIN
WH0004216M2-100UG04061831634402