Monoclonal Anti-PAK4 antibody produced in mouse

PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)

PAK4 (p21 (RAC1) activated kinase 4) belongs to the group II PAK serine/threonine kinases family. It has an N‐terminal regulatory domain and a C‐terminal kinase domain. This gene is located on human chromosome 19q13.2.

PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD

PAK4 (p21 (RAC1) activated kinase 4) is required for the viability of embryos and growth of tissues. It induces the development of cancer in vitro and in vivo. This protein plays a major role in the multiplication of cells in embryogenesis. PAK4 controls cytoskeletal dynamics, in GPR40-dependent potentiation of insulin secretion.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.