Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
Conjugate:
unconjugated
Clone:
3F10, monoclonal
Application:
ELISA (i), WB
Citations:
4
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
3F10, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
indirect ELISA: suitable, western blot: 1-5 μg/mL
isotype
IgG1κ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... PAK4(10298)
Related Categories
General description
PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)
PAK4 (p21 (RAC1) activated kinase 4) belongs to the group II PAK serine/threonine kinases family. It has an N‐terminal regulatory domain and a C‐terminal kinase domain. This gene is located on human chromosome 19q13.2.
Immunogen
PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
Sequence
KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD
Biochem/physiol Actions
PAK4 (p21 (RAC1) activated kinase 4) is required for the viability of embryos and growth of tissues. It induces the development of cancer in vitro and in vivo. This protein plays a major role in the multiplication of cells in embryogenesis. PAK4 controls cytoskeletal dynamics, in GPR40-dependent potentiation of insulin secretion.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Regulatory Information
常规特殊物品
低风险生物材料
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The P21-activated kinase PAK4 is implicated in fatty-acid potentiation of insulin secretion downstream of free fatty acid receptor 1
Bergeron V, et al.
Islets, 8(6), 157-164 (2016)
PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia
Abo A, et al.
The Embo Journal, 17(22), 6527-6540 (1998)
Activated-PAK4 predicts worse prognosis in breast cancer and promotes tumorigenesis through activation of PI3K/AKT signaling
He LF, et al.
Oncotarget, 8(11), 17573-17585 (2017)
Identification of PAK4 as a putative target gene for amplification within 19q13.12-q13.2 in oral squamous-cell carcinoma
Begum A, et al.
Cancer Science, 100(10), 1908-1916 (2009)
Global Trade Item Number
| SKU | GTIN |
|---|---|
| WH0010298M1-100UG | 04061831637199 |
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service