WH0010413M1
Monoclonal Anti-YAP1 antibody produced in mouse
clone 2F12, purified immunoglobulin, buffered aqueous solution
Synonym(s):
Anti-YAP, Anti-YAP2, Anti-YAP65, Anti-Yes-associated protein 1, 65kDa
biological source
mouse
Quality Level
conjugate
unconjugated
antibody form
purified immunoglobulin
antibody product type
primary antibodies
clone
2F12, monoclonal
form
buffered aqueous solution
species reactivity
human
technique(s)
ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL
isotype
IgG2aκ
GenBank accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... YAP1(10413)
General description
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. (provided by RefSeq)
Yes-associated protein 1 (YAP1) is a transcriptional coactivator. It possesses two WW domains, a TID domain (TEA domain family member 1 transcription factor interacting-domain), sarcoma homology 3 domain (SH3) binding motif, a proline rich region and a PDZ motif. It is expressed in eight isoforms. The YAP1 gene is localized on human chromosome 11q22.1.
Immunogen
YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Application
Monoclonal Anti-YAP1 antibody produced in mouse has been used in western blotting and co-immunoprecipitation.
Biochem/physiol Actions
Yes-associated protein 1 (YAP1) promotes cell and tissue growth. It interacts with receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP1 is an oncogenic protein and contributes to tumor progression. It is highly expressed in hedgehog-associated medulloblastomas and mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene has been shown to lead to apoptosis of prostate cancer cells and is considered as a potential target for treatment.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Regulatory Information
常规特殊物品
This item has
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
YAP promotes osteogenesis and suppresses adipogenic differentiation by regulating beta-catenin signaling.
Pan Jin-Xiu, et al.
Bone research, 6(1), 18-18 (2018)
Amot regulates neuronal dendritic tree through Yap1.
Rojek K, et al.
bioRxiv, 6(1), 345264-345264 (2018)
Kai Zhao et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 37(13), 3465-3477 (2017-02-19)
Yes-associated protein (Yap) is a major effector of the Hippo pathway that regulates cell proliferation and differentiation during development and restricts tissue growth in adult animals. However, its role in synapse formation remains poorly understood. In this study, we characterized
WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxy-terminal fragment of ErbB-4 that translocates to the nucleus.
Komuro A, et al.
The Journal of Biological Chemistry, 22(14), 1962-1971 (2003)
Tumor suppressor Nf2 limits expansion of the neural progenitor pool by inhibiting Yap/Taz transcriptional coactivators.
Lavado A, et al.
Development, 6(1), 096537-096537 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service