246 547-26-2

All Photos(1)

Levulinic acid

Synonym(s): Levulinic acid

Empirical Formula (Hill Notation): C₅H₈O₃

CAS No.:: 123-76-2
Molecular Weight:: 116.12

Compare	Product No.	Description	SDS	Pricing
	8.14254	for synthesis

All Photos(2)

4-((6-Amino-5-bromo-2-((4-cyanophenyl)amino)pyrimidin-4-yl)oxy)-3,5-dimethylbenzonitrile

Empirical Formula (Hill Notation): C₂₀H₁₅BrN₆O

CAS No.:: 269055-15-4
Molecular Weight:: 435.28

Compare	Product No.	Description	SDS	Pricing
	901779

All Photos(1)

N,N′-Diphenylbenzidine

Linear Formula: 4-(C₆H₅NH)C₆H₄C₆H₄-4-(NHC₆H₅)

CAS No.:: 531-91-9
Molecular Weight:: 336.43
EC No.:: 208-521-7
Beilstein No.:: 2220993

Compare	Product No.	Description	SDS	Pricing
	D205206	97%

All Photos(5)

1,4-Bis(5-phenyl-2-oxazolyl)benzene

Synonym(s): 1,4-Bis(5-phenyl-2-oxazolyl)benzene, 2,2′-p-Phenylene-bis(5-phenyloxazole), Di(phenyl-5-oxazolyl-2)-1,4-benzene, POPOP

Empirical Formula (Hill Notation): C₂₄H₁₆N₂O₂

CAS No.:: 1806-34-4
Molecular Weight:: 364.40
EC No.:: 217-304-6
Beilstein No.:: 325741

Compare	Product No.	Description	SDS	Pricing
	P3754	BioReagent, suitable for scintillation

All Photos(1)

(1S,2S)-N,N′-Bis(2-acetyl-3-oxo-2-butenylidene)-1,2-dimesitylethylenediaminato cobalt(II)

Synonym(s): (S,S)-AMAC

Empirical Formula (Hill Notation): C₃₂H₃₈CoN₂O₄

CAS No.:: 259259-80-8
Molecular Weight:: 573.59

Compare	Product No.	Description	SDS	Pricing
	708844

All Photos(2)

Hoveyda-Grubbs Catalyst^® M722

Synonym(s): Dichloro[1,3-bis(2,6-isopropylphenyl)-2-imidazolidinylidene](2-isopropoxyphenylmethylene)ruthenium(II)

Empirical Formula (Hill Notation): C₃₇H₅₀Cl₂N₂ORu

CAS No.:: 635679-24-2
Molecular Weight:: 710.78

Compare	Product No.	Description	SDS	Pricing
	729345	Umicore

All Photos(3)

Orange G

Synonym(s): 1-Phenylazo-2-naphthol-6,8-disulfonic acid disodium salt, 7-Hydroxy-8-phenylazo-1,3-naphthalenedisulfonic acid disodium salt, Acid Orange 10, Wool Orange 2G

Empirical Formula (Hill Notation): C₁₆H₁₀N₂Na₂O₇S₂

CAS No.:: 1936-15-8
Molecular Weight:: 452.37
EC No.:: 217-705-6
Beilstein No.:: 4120705

Compare	Product No.	Description	SDS	Pricing
	861286	certified by the Biological Stain Commission, Dye content 80 %

All Photos(2)

trihydroxycholestanoic acid

Empirical Formula (Hill Notation): C₂₇H₄₆O₅

CAS No.:: 547-98-8
Molecular Weight:: 450.65

Compare	Product No.	Description	SDS	Pricing
	700070P	Avanti Polar Lipids

All Photos(1)

N-[2-(Dansylamino)ethyl]maleimide

Synonym(s): N-(2-Maleimidoethyl)-5-dimethylamino-1-naphthalenesulfonamide, N-(2-Maleimidoethyl)dansylamide

Empirical Formula (Hill Notation): C₁₈H₁₉N₃O₄S

CAS No.:: 160291-45-2
Molecular Weight:: 373.43

Compare	Product No.	Description	SDS	Pricing
	39326	BioReagent, suitable for fluorescence, ≥99.0% (HPLC)

All Photos(1)

(1R,1′R,2S,2′S)-DuanPhos

Synonym(s): (1R,1′R,2S,2′S)-2,2′-Di-tert-butyl-2,3,2′,3′-tetrahydro-1H,1′H-(1,1′)biisophosphindolyl

Empirical Formula (Hill Notation): C₂₄H₃₂P₂

CAS No.:: 528814-26-8
Molecular Weight:: 382.46

Compare	Product No.	Description	SDS	Pricing
	657697

All Photos(1)

Chlorocyclopentadienyl[(4R,5R)-2,2-dimethyl-α,α,α′,α′-tetraphenyl-1,3-dioxolane-4,5-dimethanolato]titanium

Synonym(s): (4R,5R)-Chloro-cyclopentadienyl-[2,2-dimethyl-1,3-dioxolan-4,5-bis(diphenylmethoxy)]titanium, (R,R)-Duthaler-Hafner reagent, [(4R,5R)-2,2-Dimethyl-1,3-dioxolan-4,5-bis(diphenylmethoxy)]cyclopentadienyl-chlorotitanium

Empirical Formula (Hill Notation): C₃₆H₃₃ClO₄Ti

CAS No.:: 132068-98-5
Molecular Weight:: 612.96

Compare	Product No.	Description	SDS	Pricing
	449520	97%

All Photos(1)

6-Hydroxy-3-coumaranone

Empirical Formula (Hill Notation): C₈H₆O₃

CAS No.:: 6272-26-0
Molecular Weight:: 150.13

Compare	Product No.	Description	SDS	Pricing
	630039	97%

All Photos(1)

5′-O-Trityl-2′-deoxy-β-D-lyxofuranosylthymine

Empirical Formula (Hill Notation): C₂₉H₂₈N₂O₅

CAS No.:: 55612-11-8
Molecular Weight:: 484.54
EC No.:: 407-120-6

Compare	Product No.	Description	SDS	Pricing
	361674	98%

All Photos(1)

Hyocholic acid

Empirical Formula (Hill Notation): C₂₄H₄₀ O₅

CAS No.:: 547-75-1
Molecular Weight:: 408.57

Compare	Product No.	Description	SDS	Pricing
	700159P	Avanti Polar Lipids 700159P, powder

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description		SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6383	≥80% (HPLC), powder

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

Levulinic acid

4-((6-Amino-5-bromo-2-((4-cyanophenyl)amino)pyrimidin-4-yl)oxy)-3,5-dimethylbenzonitrile

N,N′-Diphenylbenzidine

1,4-Bis(5-phenyl-2-oxazolyl)benzene

(1S,2S)-N,N′-Bis(2-acetyl-3-oxo-2-butenylidene)-1,2-dimesitylethylenediaminato cobalt(II)

Hoveyda-Grubbs Catalyst® M722

Orange G

trihydroxycholestanoic acid

N-[2-(Dansylamino)ethyl]maleimide

(1R,1′R,2S,2′S)-DuanPhos

Chlorocyclopentadienyl[(4R,5R)-2,2-dimethyl-α,α,α′,α′-tetraphenyl-1,3-dioxolane-4,5-dimethanolato]titanium

6-Hydroxy-3-coumaranone

5′-O-Trityl-2′-deoxy-β-D-lyxofuranosylthymine

Hyocholic acid

SNX-482

SNX-482 Recombinant

Teriparatide

Parathyroid Hormone 1-34, Human

Glucagon, Human

Neuropeptide Y, Human

Insulin Chain B Oxidized from bovine pancreas

Charybdotoxin

Calcitonin Gene-Related Peptide-I, Human

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Cecropin B

Margatoxin

Cecropin A

Hoveyda-Grubbs Catalyst^® M722