2696-84-6

Applied Filters:

Keyword:'2696-84-6'

Showing 31-42 of 42 results for "2696-84-6" within Products

All Photos(1)

Suramin sodium salt

Synonym(s): Suramin, Sodium Salt

Empirical Formula (Hill Notation): C₅₁H₃₄N₆O₂₃S₆ · 6Na

CAS No.:: 129-46-4
Molecular Weight:: 1429.17

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	574625	≥98% (HPLC)	crystalline solid	100	OK to freeze, desiccated (hygroscopic)

All Photos(2)

7-Methylindole

Empirical Formula (Hill Notation): C₉H₉N

CAS No.:: 933-67-5
Molecular Weight:: 131.17
EC No.:: 213-270-1
Beilstein No.:: 111088

Compare	Product No.	Description					SDS	Pricing
	M51490	97%

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description					SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description					SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	SML1150	≥98% (HPLC)	lyophilized powder	100	—

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description					SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description					SDS	Pricing
	M8278

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	401002	≥98% (HPLC)	lyophilized solid (Salt-free)	100	OK to freeze

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description					SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description					SDS	Pricing
	C7802	≥90% (HPLC), voltage-gated potassium channel blocker, powder

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description					SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Hypercalcemia of malignancy factor fragment 1-34 amide human

Synonym(s): Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-NH₂, PTHrP (1-34) amide, Parathyroid hormone-related protein (1-34) Amide

Empirical Formula (Hill Notation): C₁₈₀H₂₈₈N₅₈O₄₇

CAS No.:: 112955-31-4
Molecular Weight:: 4016.57

Compare	Product No.	Description					SDS	Pricing
	H9148	≥97% (HPLC)

Page 2 of 2