215-211-5

Applied Filters:

Keyword:'215-211-5'

Showing 1-30 of 35 results for "215-211-5" within Products

All Photos(1)

Tetrabutylammonium perchlorate

Linear Formula: (CH₃CH₂CH₂CH₂)₄N(ClO₄)

CAS No.:: 1923-70-2
Molecular Weight:: 341.91
EC No.:: 217-655-5
Beilstein No.:: 3579274

Compare	Product No.	Description	SDS	Pricing
	86893	for electrochemical analysis, ≥99.0%

All Photos(1)

4-Amino-3-hydroxybenzoic acid

Linear Formula: H₂NC₆H₃(OH)CO₂H

CAS No.:: 2374-03-0
Molecular Weight:: 153.14
Beilstein No.:: 509859

Compare	Product No.	Description	SDS	Pricing
	339598	97%

All Photos(1)

4-Amino-5-phenyl-4H-1,2,4-triazole-3-thiol

Empirical Formula (Hill Notation): C₈H₈N₄S

CAS No.:: 22706-11-2
Molecular Weight:: 192.24

Compare	Product No.	Description	SDS	Pricing
	675008	97%

All Photos(1)

4-Bromo-2-fluorobenzoic acid

Linear Formula: BrC₆H₃(F)COOH

CAS No.:: 112704-79-7
Molecular Weight:: 219.01

Compare	Product No.	Description	SDS	Pricing
	392383	97%

All Photos(1)

Amiloride impurity A

Synonym(s): Methyl 3,5-diamino-6-chloropyrazine-2-carboxylate

Empirical Formula (Hill Notation): C₆H₇ClN₄O₂

CAS No.:: 1458-01-1
Molecular Weight:: 202.60

Compare	Product No.	Description	SDS	Pricing
	Y0000020	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Synonym(s): Methyl 3,5-diamino-6-chloropyrazine-2-carboxylate

Empirical Formula (Hill Notation): C₆H₇ClN₄O₂

CAS No.:: 1458-01-1
Molecular Weight:: 202.60

Compare	Product No.	Description	SDS	Pricing
	1019712	United States Pharmacopeia (USP) Reference Standard
	PHR2061	Pharmaceutical Secondary Standard; Certified Reference Material

All Photos(1)

Empirical Formula (Hill Notation): C₆H₇ClN₄O₂

CAS No.:: 1458-01-1
Molecular Weight:: 202.60

Compare	Product No.	Description	SDS	Pricing
	596833	98%
	BP920	British Pharmacopoeia (BP) Reference Standard

All Photos(2)

2-(2-Aminophenyl)-1H-benzimidazole

Empirical Formula (Hill Notation): C₁₃H₁₁N₃

CAS No.:: 5805-39-0
Molecular Weight:: 209.25
EC No.:: 227-361-9

Compare	Product No.	Description	SDS	Pricing
	642681	97%

All Photos(1)

PACAP 27 Amide, Ovine

Synonym(s): PACAP 27 Amide, Ovine

Empirical Formula (Hill Notation): C₁₄₂H₂₂₄N₄₀O₃₉S

CAS No.:: 127317-03-7
Molecular Weight:: 3147.61

Compare	Product No.	Description	SDS	Pricing
	05-23-2151	Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

All Photos(1)

Calcitonin, Salmon

Synonym(s): Calcitonin, Salmon

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description	SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(3)

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

Linear Formula: [NH₂(CH₂)₂NH₂]:(G=2);dendri PAMAM(NH₂)₁₆

CAS No.:: 93376-66-0
Molecular Weight:: 3256.18

Compare	Product No.	Description	SDS	Pricing
	412406	20 wt. % in methanol

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:: 146897-68-9

Compare	Product No.	Description	SDS	Pricing
	L-047	certified reference material, pkg of 50 mg, Cerilliant^®

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.:: 133514-43-9
Molecular Weight:: 3369.76

Compare	Product No.	Description	SDS	Pricing
	E7269	≥95% (HPLC)

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Description	SDS	Pricing
	401002

All Photos(1)

Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6383	≥80% (HPLC), powder

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description	SDS	Pricing
	M8278

All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C₁₇₆H₃₀₁N₅₁O₄₂S

CAS No.:: 80451-05-4
Molecular Weight:: 3835.65

Compare	Product No.	Description	SDS	Pricing
	C1796	≥97% (HPLC), powder

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description	SDS	Pricing
	C6830	≥97% (HPLC), powder

All Photos(1)

Nisin Ready Made Solution

Empirical Formula (Hill Notation): C₁₄₃H₂₃₀N₄₂O₃₇S₇

CAS No.:: 1414-45-5
Molecular Weight:: 3354.07

Compare	Product No.	Description	SDS	Pricing
	SBR00021	(20,000-40,000 IU/mL in 0.02N HCl)

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description	SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description	SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C₁₄₇H₂₅₃N₄₅O₄₃

CAS No.:: 125667-96-1
Molecular Weight:: 3338.86

Compare	Product No.	Description	SDS	Pricing
	C7927	≥95% (HPLC), powder

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

Page 1 of 2

215-211-5

Tetrabutylammonium perchlorate

4-Amino-3-hydroxybenzoic acid

4-Amino-5-phenyl-4H-1,2,4-triazole-3-thiol

4-Bromo-2-fluorobenzoic acid

Amiloride impurity A

Amiloride Related Compound A

Methyl 3,5-diamino-6-chloropyrazine-2-carboxylate

2-(2-Aminophenyl)-1H-benzimidazole

PACAP 27 Amide, Ovine

Calcitonin, Salmon

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Glucagon, Human

Calcitonin Gene-Related Peptide-I, Human

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

Parathyroid Hormone 1-34, Human

Lactoferrin (from bovine milk)

Neuropeptide Y, Human

Exendin Fragment 9-39

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Insulin Chain B Oxidized from bovine pancreas

Margatoxin

Cecropin B

SNX-482

Cecropin A

Nisin Ready Made Solution

Charybdotoxin

Teriparatide

bis-MPA-Acetylene dendrimer

Cecropin P1 Porcine

SNX-482 Recombinant