2835-82-7

Applied Filters:

Keyword:'2835-82-7'

Showing 31-60 of 66 results for "2835-82-7" within Products

All Photos(1)

Insulin-Like Growth Factor Binding Protein-2 human

Synonym(s): IGFBP-2

Compare	Product No.	Description					SDS	Pricing
	I5403	recombinant, expressed in NSO cells, lyophilized powder, suitable for cell culture, ≥95% (SDS-PAGE)

All Photos(1)

BNP (1-32), human

CAS No.:: 114471-18-0
Molecular Weight:: 3464.08

Compare	Product No.	Description						Pricing
	ST9H9BC137E8

All Photos(2)

Anti-Glycoprotein 78 Antibody, clone 3F3A

Compare	Product No.	Clonality	Application	Species Reactivity	Citations					SDS	Pricing
	MABC949	3F3A, monoclonal	ICC, IHC, WB	mouse, human	1

All Photos(1)

Gastric Inhibitory Polypeptide human

Synonym(s): GIP, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Empirical Formula (Hill Notation): C₂₂₆H₃₃₈N₆₀O₆₆S

CAS No.:: 100040-31-1
Molecular Weight:: 4983.53

Compare	Product No.	Description					SDS	Pricing
	G2269	≥95% (HPLC), suitable for ligand binding assays

All Photos(1)

ProteoMass^™ Insulin MALDI-MS Standard

Synonym(s): Insulin from bovine pancreas

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Description					SDS	Pricing
	I6279	vial of 10 nmol, monoisotopic mol wt 5,729.6087 Da

All Photos(2)

Insulin from porcine pancreas

Synonym(s): Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54
EC No.:: 235-703-3

Compare	Product No.	Biological Source	Form	Assay					SDS	Pricing
	I5523	Porcine pancreas	powder	≥98%

All Photos(8)

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description					SDS	Pricing
	I0908	meets USP testing specifications
	I2643	recombinant, expressed in yeast (proprietary host)
	11376497001	recombinant (yeast)
	I3536	recombinant, expressed in yeast, γ-irradiated, suitable for cell culture
	1342106	United States Pharmacopeia (USP) Reference Standard

All Photos(1)

Insulin (porcine)

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description					SDS	Pricing
	I0320000	European Pharmacopoeia (EP) Reference Standard

All Photos(9)

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Biological Source	Form	Assay					SDS	Pricing
	I5500	—	powder	—
	I6634	bovine	powder	—

All Photos(1)

Insulin, Human Recombinant

Synonym(s): Insulin sodium salt human

CAS No.:: 11061-68-0
EC No.:: 234-279-7

Compare	Product No.	Description					SDS	Pricing
	91077C	for research or for further manufacturing use, dry powder

All Photos(1)

Insulin porcine for system suitability

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description					SDS	Pricing
	Y0001717	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Insulin solution human

CAS No.:: 11061-68-0

Compare	Product No.	Biological Source	Form	Assay					SDS	Pricing
	I9278	—	solution	—

All Photos(1)

Human Insulin

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description					SDS	Pricing
	PHR8925	certified reference material, pharmaceutical secondary standard

All Photos(1)

Insulin (Pork)

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description					SDS	Pricing
	1342300	United States Pharmacopeia (USP) Reference Standard

All Photos(1)

NFAT Inhibitor

Synonym(s): NFAT Inhibitor

Empirical Formula (Hill Notation): C₇₅H₁₁₈N₂₀O₂₂S

CAS No.:: 249537-73-3
Molecular Weight:: 1683.93

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	480402	≥95% (HPLC)	lyophilized solid	100	OK to freeze, desiccated (hygroscopic)

All Photos(1)

Amyloid Protein Non-Aβ Component

Synonym(s): NAC

Empirical Formula (Hill Notation): C₁₄₁H₂₃₅N₃₉O₄₉

CAS No.:: 154040-19-4
Molecular Weight:: 3260.61

Compare	Product No.	Form	Assay	Biological Source	Recombinant					SDS	Pricing
	A2835	solid	≥80% (HPLC)	—	—

All Photos(3)

Synonym(s): sec-Propyl alcohol, IPA, Isopropanol, Isopropyl alcohol

Linear Formula: (CH₃)₂CHOH

CAS No.:: 67-63-0
Molecular Weight:: 60.10
Beilstein No.:: 635639

Compare	Product No.	Description					SDS	Pricing
	1.01040	≥99.9% (GC), gradient grade, suitable for HPLC, LiChrosolv^®
	1.02781	≥99.9% (GC), suitable for LC/MS, suitable for ASTM^® 7979, EPA 8327, ASTM^® 7968, LiChrosolv^®

All Photos(1)

Voclosporin

Synonym(s): 6-[(2S,3R,4R,6E)-3-Hydroxy-4-methyl-2-(methylamino)-6,8-nonadienoic acid]cyclosporin A, Cyclosporin A, 6-[(2S,3R,4R,6E)-3-hydroxy-4-methyl-2-(methylamino)-6,8-nonadienoic acid]-, ISATX247, LX 214, R 1524

Empirical Formula (Hill Notation): C₆₃H₁₁₁N₁₁O₁₂

CAS No.:: 515814-01-4
Molecular Weight:: 1214.62

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	SML3108	≥95% (HPLC)	film or powder	100	—

All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description					SDS	Pricing
	05-23-5501	N-terminal active peptide fragment of the native hormone that functions as a regulatory factor in the homeostatic control of Ca²⁺ and phosphate metabolism.

All Photos(1)

Margatoxin

Synonym(s): MgTx

Empirical Formula (Hill Notation): C₁₇₈H₂₈₆N₅₂O₅₀S₇

CAS No.:: 145808-47-5
Molecular Weight:: 4178.95

Compare	Product No.	Description					SDS	Pricing
	M8278

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description					SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Neuropeptide Y, Human

Synonym(s): Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description					SDS	Pricing
	05-23-2005	A potent vasoconstrictor.

All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli

CAS No.:: 129203-60-7

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	401002	≥98% (HPLC)	lyophilized solid (Salt-free)	100	OK to freeze

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description					SDS	Pricing
	C7802	≥90% (HPLC), voltage-gated potassium channel blocker, powder

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	SML1150	≥98% (HPLC)	lyophilized powder	100	—

All Photos(1)

Teriparatide

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)

Empirical Formula (Hill Notation): C₁₈₁H₂₉₁N₅₅O₅₁S₂

CAS No.:: 52232-67-4
Molecular Weight:: 4117.72

Compare	Product No.	Description					SDS	Pricing
	PHR8659	certified reference material, pharmaceutical secondary standard

All Photos(1)

Calcitonin, Salmon

Synonym(s): Calcitonin, Salmon

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description					SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description					SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human

Empirical Formula (Hill Notation): C₁₆₃H₂₆₇N₅₁O₄₉S₂

CAS No.:: 90954-53-3
Molecular Weight:: 3789.31

Compare	Product No.	Description					SDS	Pricing
	05-23-2404	Calcitonin Gene-Related Peptide-I, Human, CAS 90954-53-3, is a potent and long-acting vasodilator. Increases plasma levels of pancreatic polypeptide. Has chemotactic activity towards eosinophils.

All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C₁₈₄H₃₁₃N₅₃O₄₆

CAS No.:: 80451-04-3
Molecular Weight:: 4003.78

Compare	Product No.	Description					SDS	Pricing
	C6830	≥97% (HPLC), powder

Page 2 of 3

2835-82-7

Insulin-Like Growth Factor Binding Protein-2 human

BNP (1-32), human

Anti-Glycoprotein 78 Antibody, clone 3F3A

Gastric Inhibitory Polypeptide human

ProteoMass™ Insulin MALDI-MS Standard

Insulin from porcine pancreas

Insulin human

Insulin (porcine)

Insulin from bovine pancreas

Insulin, Human Recombinant

Insulin porcine for system suitability

Insulin solution human

Human Insulin

Insulin (Pork)

NFAT Inhibitor

Amyloid Protein Non-Aβ Component

2-Propanol

Voclosporin

Parathyroid Hormone 1-34, Human

Margatoxin

bis-MPA-Acetylene dendrimer

Neuropeptide Y, Human

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Charybdotoxin

SNX-482 Recombinant

Teriparatide

Calcitonin, Salmon

Glucagon, Human

Calcitonin Gene-Related Peptide-I, Human

Cecropin A

ProteoMass^™ Insulin MALDI-MS Standard