Monoclonal Anti-S100A4 antibody produced in mouse

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. (provided by RefSeq)

S100A4 (AAH16300, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK

Members of S100 calcium-binding protein family, including S100A4, play a vital role in regulation of cell growth, motility, cell cycle, transcription and differentiation. Increased expression of S100A4 leads to thyroid tumor invasion and metastasis and it might act as a potential marker for thyroid carcinoma. Increased expression of serum S100A4, acts as a potential biomarker for the diagnosis of acute myocardial infarction (AMI). S100A4 might have a role in the homeostasis of growth and is also implicated in growth factor signal transduction and apoptosis. Overexpression of S100A4, is associated with pathogenesis of human breast cancer and pancreatic ductal adenocarcinomas.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.