CN
144-29-6
应用筛选条件
关键词:'144-29-6'
显示 1-30 共 97 条结果 关于 "144-29-6" 范围 技术文档
Rotary Evaporator Replacement Glassware
Buchi® Model Buchi® Ref. Cat. No.
24/40 200-205 40616 Z682187-1EA
29/32 200-205 40615 Z682209-1EA
29/42 200-205 40617 Z682217-1EA
24/40 114-144 23747 Z682195-1EA
Vapor Duct Tube, For Condenser “A” Assembly
Spare parts for Mobius® FlexReady Solution with Smart Flexware® Assemblies For Chromatography and TFF
149
78
134
140
145 152
144
141
139
142
129
135
133 126
128
149
132
143
127
131
1301
2
Quality Control Ranges: MILLIPLEX® MAP Mouse High Sensitivity T Cell Magnetic Bead Panel
IL-6 Control 1 37 – 78 pg/mL MIP-2 Control 1 310 – 711 pg/mL
Control 2 154 – 319 pg/mL Control 2 1241 – 2577 pg/mL
Product Information Sheet - P7769
Liposomes. J. Mol. Biol., 236(1),
199-208 (1994).
6. Sanders, H., Preparative Isolation of Phosphatidyl
Serine from Brain. Biochim. Biophys. Acta, 144(2),
485-487 (1967).
RLG/RXR 10/02
Sigma brand
QUALITY CONTROL RANGES - Milliplex Mouse CD8%26#43; T Cell Magnetic Bead Panel
298 – 618 pg/mL IL-6 Control 1 151– 313 pg/mL
Control 2 2383 – 4949 pg/mL Control 2 1234 – 2563 pg/mL
Fas
MILLIPORE IHC SELECT RESEARCH® PREDILUTED MOUSE ANTI-NESTIN
IHCR1006-6.doc
28820 Single Oak Drive • Temecula, CA 92590
Technical Support: T: 1-800-MILLIPORE (1-800-645-5476) • F: 1-800-437-7502
Data Sheet - P5542
Phospholipase C from
Bacillus cereus in Complex with Glucosaminyl
(α 1→6)-D-myo-inositol, an Essential Fragment of
GPI Anchors. Biochemistry, 35(29), 9496-9504
(1996).
4. Taguchi, R., et al, Purification and
Data Sheet - P0243
Res., 144, 73-82 (1983).
2. Bermbach, U. and Faulstich, H., Epidermal growth
factor labeled beta-amanitin-poly-L-ornithine:
preparation and evidence for specific cytotoxicity.
Biochemistry, 29, 6839-
Product Information Sheet - G3126
Distinguishing features of leucine
and α-ketoisocaproate sensing in pancreatic beta-
cells. Endocrinology, 144(5), 1949-1957 (2003).
GCY/RXR 11/03
Sigma brand products are sold through Sigma-Aldrich
Product Information Sheet - A3785
Description
Molecular formula: C5H9NO3 ⋅ HCl
Molecular weight: 167.59
Melting Point: 144-151 °C 1
pKa: 4.05 and 8.90 at 25 °C 1
Method of preparation:
A 3785 is prepared synthetically
Data Sheet - B0814
solution of
0.05 M Tris-HCl, pH 7.4
Molecular mass: ∼16.5 kDa
Sequence: single chain, containing 144 amino residues
HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY
YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP
Aldrich Polymer Products Application - Transitions
200
4-Methylpentene 29 250
Methylphenylsiloxane -86
Methylstyrene 20
3-Methylstyrene 97
4-Methylstyrene 97
Methyl vinyl ether -31 144
Nylon 4,6 (tetramethylene adipamide) 43
Nylon 6 (-caprolactam) 52 225
Data Sheet - I3157
4. Petit-Frere, C., et al., Cytokine, 3, 466 (1991).
5. Renauld, J., et al., J. Immunol., 144, 4235 (1990).
6. Chang, M.S., et al., Blood, 83, 3199-3205 (1994).
kaa 02/03
Data Sheet - T1450
1995).
12. Moritz, M., et al., Nature, 378, 638-640 (1995).
13. Oegema, K., et al., J. Cell Biol., 144, 721-733
(1999).
KAA/ER 05/04
Data Sheet - T3320
578 (1995).
12. Moritz., M. et al., Nature, 378, 638 (1995).
13. Oegema, K. et al., J. Cell Biol., 144, 721 (1999).
VS, MG,KAA,PHC,MAM 02/19-1
Data Sheet - T0950
1995).
11. Moritz, M., et al., Nature, 378, 638-640 (1995).
12. Oegema, K., et al., J. Cell Biol., 144, 721-733
(1999).
KAA/ER 04/04
Data Sheet - T5192
1995).
12. Moritz., M., et al., Nature, 378, 638 (1995).
13. Oegema, K., et al., J. Cell Biol., 144, 721 (1999).
lpg 1/01
Sigma brand products are sold through Sigma-Aldrich
Data Sheet - T3195
578 (1995).
12. Moritz., M., et al., Nature, 378, 638 (1995).
13. Oegema, K., et al., J. Cell Biol., 144, 721 (1999).
DS,KAA,PHC 10/12-1
2012 Sigma-Aldrich Co. LLC. All rights reserved. SIGMA-ALDRICH
Data Sheet - A5691
, A., et al., Differentiation, 43, 115
(1990).
6 Jahoda, C., et al., J. Cell Sci., 99, 627 (1991).
7. Sappino, A., et al., Lab. Invest., 63, 144 (1990).
8. Ruzicka, D., et al., J. Cell Biol., 107
Data Sheet - C6198
, A., et al., Differentiation, 43, 115
(1990).
6. Jahoda, C., et al., J. Cell Sci., 99, 627 (1991).
7. Sappino, A., et al., Lab. Invest., 63, 144 (1990).
8. Ruzicka, D., and Schwartz, R., J. Cell Biol
Data Sheet - F3777
A., et al., Differentiation, 43, 115
(1990).
6. Jahoda, C., et al., J. Cell Sci., 99, 627 (1991).
7. Sappino, A., et al., Lab. Invest., 63, 144 (1990).
8. Ruzicka, D., and Schwartz, R.
Data Sheet - C7604
).
14. Oegema, K., et al., J. Cell Biol., 144, 721 (1999).
Cy is a trademark of Amersham Pharmacia Biotech and
is distributed under license.
kaa/lpg 6/03
Sigma brand products are
Product Information Sheet - L5385
3. Zittle, C. A., Solubility transformation of alpha-
lactalbumin. Arch. Biochem. Biophys., 64, 144-51
(1956).
4. Kronman, M. J. and Andreotti, R. E., Inter- and
Intramolecular Interactions of
Product Information Sheet - L6010
3. Zittle, C. A., Solubility transformation of alpha-
lactalbumin. Arch. Biochem. Biophys., 64, 144-51
(1956).
4. Kronman, M. J. and Andreotti, R. E., Inter- and
Intramolecular Interactions of
Product Information Sheet - L2524
1
experiment 31: Plasmid DNA isolation from
yeast". Wiley-Blackwell (Hoboken, NJ),
pp. 143-144 (2017).
Notice
We provide information and advice to our customers
on application technologies
Data Sheet - N5408
et al., J. Biol. Chem., 260, 8044
(1985).
5. DiStefano, P.S., et al., Ann. Neurol., 29, 13
(1991).
6. Cattoretti, G., et al., Blood, 81, 1726 (1993).
7. Suburo, A.M., et al., Neuroscience, 50
Data Sheet - N6163
Grob, P.M., et al., J. Biol. Chem., 260, 8044 (1985).
5. DiStefano, P.S., et al., Ann. Neurol., 29, 13 (1991).
6. Cattoretti, G., et al., Blood, 81, 1726 (1993).
7. Suburo, A.M., et al., Neuroscience, 50
User Guide - SEQXI
ng 14
Note: If more than 29 cycles are required to
achieve plateau, subsequent NGS results may be
unsatisfactory. Consult the Troubleshooting Guide.
Figure 1
6. Cap tube(s) and mix thoroughly
Data Sheet - N5788
Grob, P.M. et al., J. Biol. Chem., 260, 8044 (1985).
5. DiStefano, P.S. et al., Ann. Neurol., 29, 13 (1991).
6. Cattoretti, G. et al., Blood, 81, 1726 (1993).
7. Suburo, A.M. et al., Neuroscience, 50, 467
Product Information Sheet - S0501
#8794, p. 1480, 1996.
34. Clarke’s Isolation and Identification of Drugs, 2nd ed., ed. Moffat, A.C., 144, The Pharmaceutical
Press, London, 1986.
35. Data for Biochemical Research, Eds. Dawson, R.M.C.
1/4