CN
850345C
应用筛选条件
关键词:'850345C'
显示 1-30 共 140 条结果 关于 "850345C" 范围 论文
Quantitative assays for esterified oxylipins generated by immune cells.
Morgan AH, et al.
Nature Protocols, 5(12), 1919-1931 (2010)
Rosendo Pérez-Isidoro et al.
Biochimica et biophysica acta. Biomembranes, 1862(2), 183099-183099 (2019-11-08)
Despite decades of intense research to understand the phenomenon of anesthesia and its membrane-related changes in neural transmission, where lipids and proteins have been proposed as primary targets of anesthetics, the involved action mechanisms remain unclear. Based on the overall
Anik Forest et al.
Journal of proteome research, 17(11), 3657-3670 (2018-09-27)
The goal of this work was to develop a label-free, comprehensive, and reproducible high-resolution liquid chromatography-mass spectrometry (LC-MS)-based untargeted lipidomic workflow using a single instrument, which could be applied to biomarker discovery in both basic and clinical studies. For this
The Membranes of Cells (2016)
Noncanonical regulation of phosphatidylserine metabolism by a Sec14-like protein and a lipid kinase.
Yaxi Wang et al.
The Journal of cell biology, 219(5) (2020-04-19)
The yeast phosphatidylserine (PtdSer) decarboxylase Psd2 is proposed to engage in a membrane contact site (MCS) for PtdSer decarboxylation to phosphatidylethanolamine (PtdEtn). This proposed MCS harbors Psd2, the Sec14-like phosphatidylinositol transfer protein (PITP) Sfh4, the Stt4 phosphatidylinositol (PtdIns) 4-OH kinase
Amir Abbas Momtazi-Borojeni et al.
BMC medicine, 17(1), 223-223 (2019-12-11)
Proprotein convertase subtilisin/kexin 9 (PCSK9) is an important regulator of low-density lipoprotein receptor (LDLR) and plasma levels of LDL cholesterol (LDL-C). PCSK9 inhibition is an efficient therapeutic approach for the treatment of dyslipidemia. We tested the therapeutic effect of a
Amir Abbas Momtazi-Borojeni et al.
Archives of medical science : AMS, 16(1), 189-199 (2020-02-14)
Inhibition of proprotein convertase subtilisin/kexin 9 (PCSK9) is an established modality for the treatment of hypercholesterolaemia. However, the impact of PCSK9 inhibition in other situations such as cancer remains largely unknown. The current study was conducted to study the effects
Miranda L Schmidt et al.
Biochimica et biophysica acta. Biomembranes, 1862(5), 183196-183196 (2020-01-21)
Lipid bilayers form the basis of cell membranes and the phase behaviour of the membrane has been linked to proper cell function. Model membranes composed of relatively simple mixtures of phospholipids and cholesterol can already exhibit complex phase behaviour. Specifically
Stephen C L Hall et al.
Journal of colloid and interface science, 574, 272-284 (2020-04-25)
Over recent years, there has been a rapid development of membrane-mimetic systems to encapsulate and stabilize planar segments of phospholipid bilayers in solution. One such system has been the use of amphipathic copolymers to solubilize lipid bilayers into nanodiscs. The
Jody Vykoukal et al.
Langmuir : the ACS journal of surfaces and colloids, 19(6), 2425-2433 (2003-03-18)
We have used self-assembled monolayer techniques to produce a new class of microspheres with specifically engineered dielectric properties to enable their dielectrophoretic manipulation and identification in microsystems. Dielectrophoresis is an electrokinetic phenomenon that exploits frequency-dependent polarizability differences between a particle
Harmen B B Steele et al.
Biochemistry, 59(22), 2055-2068 (2020-05-20)
Oxidation of cardiolipin (CL) by cytochrome c (cytc) has been proposed to initiate the intrinsic pathway of apoptosis. Domain-swapped dimer (DSD) conformations of cytc have been reported both by our laboratory and by others. The DSD is an alternate conformer
Philippe Calvez et al.
Journal of the American Chemical Society (2016-10-01)
Recoverin undergoes a calcium-myristoyl switch during visual phototransduction. Indeed, calcium binding by recoverin results in the extrusion of its myristoyl group, which allows its membrane binding. However, the contribution of particular lipids and of specific amino acids of recoverin in
Huamei He et al.
Journal of controlled release : official journal of the Controlled Release Society, 323, 387-397 (2020-04-25)
Chemotherapy is an important modality available for cancer treatment. However, the present chemotherapy is still far from being satisfactory mainly owing to the severe side effects of the chemotherapeutic agents and drug resistance of cancer cells. Thus, reversing drug resistance
Jing Yu et al.
Soft matter, 16(4), 983-989 (2019-12-19)
The structure and dynamics of lipid membranes in the presence of extracellular macromolecules are critical for cell membrane functions and many pharmaceutical applications. The pathogen virulence-suppressing end-phosphorylated polyethylene glycol (PEG) triblock copolymer (Pi-ABAPEG) markedly changes the interactions with lipid vesicle
Wei He et al.
Nanomedicine : nanotechnology, biology, and medicine, 24, 102154-102154 (2020-01-27)
In vivo delivery of large RNA molecules has significant implications for novel gene therapy, biologics delivery, and vaccine applications. We have developed cationic nanolipoprotein particles (NLPs) to enhance the complexation and delivery of large self-amplifying mRNAs (replicons) in vivo. NLPs
Dominique Mias-Lucquin et al.
Journal of structural biology, 209(1), 107411-107411 (2019-11-07)
Dystrophin is a large intracellular protein that prevents sarcolemmal ruptures by providing a mechanical link between the intracellular actin cytoskeleton and the transmembrane dystroglycan complex. Dystrophin deficiency leads to the severe muscle wasting disease Duchenne Muscular Dystrophy and the milder
Eric Oropeza-Guzman et al.
Langmuir : the ACS journal of surfaces and colloids, 34(23), 6869-6873 (2018-05-22)
An environmentally friendly and straightforward dehydration/rehydration method for glycerophospholipid mixing that avoids the use of organic solvents, cosolvents, or additives was developed. We prepared binary mixtures of zwitterionic and anionic glycerophospholipids using only deionized water in the entire mixing process.
Alessandro Piai et al.
Nature communications, 11(1), 2317-2317 (2020-05-10)
The prefusion conformation of HIV-1 envelope protein (Env) is recognized by most broadly neutralizing antibodies (bnAbs). Studies showed that alterations of its membrane-related components, including the transmembrane domain (TMD) and cytoplasmic tail (CT), can reshape the antigenic structure of the
L Bakás et al.
Biophysical journal, 71(4), 1869-1876 (1996-10-01)
Alpha-Hemolysin is an extracellular protein toxin (107 kDa) produced by some pathogenic strains of Escherichia coli. Although stable in aqueous medium, it can bind to lipid bilayers and produce membrane disruption in model and cell membranes. Previous studies had shown
H A Pérez et al.
Langmuir : the ACS journal of surfaces and colloids, 36(10), 2644-2653 (2020-02-20)
The lack of carbonyl groups and the presence of ether bonds give the lipid interphase a different water organization around the phosphate groups that affects the compressibility and electrical properties of lipid membranes. Generalized polarization of 1,2-di-O-tetradecyl-sn-glycero-3-phosphocholine (14:0 diether PC)
Hitoshi Matsuki et al.
Biochimica et biophysica acta. Biomembranes, 1862(5), 183197-183197 (2020-01-21)
The bilayer phase transitions of medium-chain phosphatidylcholines with linear saturated acyl chains (Cn = 12, 13 and 14) were measured by high-pressure light-transmittance measurements and differential scanning calorimetry to investigate the formation of intermediate gel-liquid crystalline phase called Lx phase. The constructed
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Yeasmin Sarkar et al.
Soft matter, 16(3), 798-809 (2019-12-14)
Achieving controlled membrane permeability using pH-responsive block copolymers is crucial for selective intercellular uptake. We have shown that the pH at the triblock-copolymer micelle interface as compared to its bulk pH can help regulate membrane permeability. The pH-dependent acid/base equilibriums
Gregory Brubaker et al.
PloS one, 15(1), e0221915-e0221915 (2020-01-17)
The crystal structure of a C-terminal deletion of apolipoprotein A-I (apoA1) shows a large helical bundle structure in the amino half of the protein, from residues 8 to 115. Using site directed mutagenesis, guanidine or thermal denaturation, cell free liposome
Rosana Ribić et al.
The journal of physical chemistry. B, 124(20), 4132-4145 (2020-04-15)
We present an in-depth investigation of the membrane interactions of peptidoglycan (PGN)-based immune adjuvants designed for lipid-based delivery systems using NMR spectroscopy. The derivatives contain a cargo peptidoglycan (PGN) dipeptide fragment and an adamantyl group, which serves as an anchor
Idalia M Sandoval-Jiménez et al.
The Journal of chemical physics, 152(1), 014901-014901 (2020-01-10)
We present a method that takes advantage of the Brownian motion of a colloidal particle to experimentally determine the area stretch modulus of giant liposomes in solution, in regard to the continuum mechanics theory of elasticity. The characteristic parameters of
DeeAnn K Asamoto et al.
Biophysical journal, 118(2), 403-414 (2019-12-18)
Nanodiscs (NDs) are an excellent alternative to small unilamellar vesicles (SUVs) for studies of membrane protein structure, but it has not yet been shown that membrane proteins are able to spontaneously fold and insert into a solution of freely diffusing
Geetanjali Meher et al.
Langmuir : the ACS journal of surfaces and colloids, 34(6), 2344-2351 (2018-01-13)
Eugenol is known for its antimicrobial effects against microorganisms responsible for infectious diseases in humans, food-borne pathogens, and oral pathogens. In spite of several reports on the antimicrobial function of eugenol by modulating the structural properties of cell membranes, there
Paulina Perczyk et al.
Biochimica et biophysica acta. Biomembranes, 1862(2), 183136-183136 (2019-11-22)
Soil fungi play an important role in the environment decomposing dead organic matter and degrading persistent organic pollutants (POP). The presence of hydrophobic POP in the soil and membrane-lytic substances excreted by competing microorganism to the soil solution is the
Sara J Sustich et al.
Biochimica et biophysica acta. Biomembranes, 1862(2), 183134-183134 (2019-11-19)
The transmembrane helices of membrane proteins often are flanked by interfacial charged or aromatic residues that potentially help to anchor the membrane-spanning protein. For isolated single-span helices, the interfacial residues may be especially important for stabilizing particular tilted transmembrane orientations.
1/5