mature
76 amino acid variant of the chemokine domain of
mature rat fractalkine (amino acid residues 25 to 100,
QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKR
AIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTR
NG).1 Rat fractalkine
concentration by
titration test.
References
1. Lamas A., et al., Microbiol Res., 206:
60-73 (2018).
2. Dos Santos AMP., et al., Curr Microbiol., 76:
762-773 (2019).
3. Yang L. and Li
and
mDia1, in transformation, metastasis and invasion.
Cancer Metastasis Rev., 28(1-2), 65-76 (2009).
RC,MAM 11/11-1
2011 Sigma-Aldrich Co. LLC. All rights reserved. SIGMA-ALDRICH is a trademark
Avoid repeated handling
and multiple freeze/thaw cycles.
Figure 1.
SDS-PAGE Gel of Typical Lot
70–95% (densitometry)
References
1. Jensen, L.R. et al., Mutations in the JARID1C gene,
which is
.1 mM EDTA,
0.25 mM DTT, 0.1 mM PMSF, and 25% glycerol.
Molecular mass: ∼76 kDa
Purity: 70–95% (SDS-PAGE, see Figure 1)
Precautions and Disclaimer
This product is for R&D use only, not for drug
REFERENCE:
Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical
Corporation, Freehold, NJ
NOTES:
1. This assay is based on the cited reference.
2. Where Sigma Product
REFERENCE:
Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical
Corporation, Freehold, NJ
NOTES:
1. This assay is based on the cited reference.
2. Where Sigma Product
REFERENCE:
Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical
Corporation, Freehold, NJ
NOTES:
1. This assay is based on the cited reference.
2. Where Sigma Product
c mice immunized with a synthetic peptide
corresponding to amino acids 61-76 of the mouse Bcl-2
sequence conjugated to KLH.1 The isotype is
determined by a double diffusion immunoassay using
Mouse
stain 1 x 10 , cells a fluorescence intensity is
is constitutively expressed on most peripheral blood T observed similar to that obtained with saturating monoclonal
lymphocytes (approximately 95% of CD4
1.0 μg/mL using 1 μg/mL of control peptide to coat plate.
Optimal working dilutions must be determined by the end user.
SPECIES REACTIVITY:
Rat. The immunogen peptide has 95% homology with
This product is soluble in 95% ethanol (50 mg/ml),
yielding a clear faint yellow solution. Heat may be
required to get it to dissolve at that concentration.
References
1. The Merck Index, 11th ed.
. Curr. Heart Fail. Rep., 11(1):
58–63 (2014).
3. Verdecchia, P. et al., The pivotal link between
ACE2 deficiency and SARS-CoV-2 infection. Eur. J.
Intern. Med., 76: 14-20 (2020).
4. Hoffmann
and inhibit initial adsorption to susceptible cells. 25
References:
1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954).
2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568 (1955).
stimulated by UV light and Ha-Ras that binds and
phosphorylates the c-Jun activation domain. Cell,
76, 1025-1037 (1994).
7. Kyriakis, J.M., et al., The stress-activated protein
kinase subfamily of
and inhibit initial adsorption to susceptible cells. 25
References:
1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954).
2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568 (1955).