95-76-1

应用筛选条件

关键词:'95-76-1'

显示 1-30 共 345 条结果关于 "95-76-1" 范围技术文档

The Effective Use of Protein Kinase Inhibitors

102 101 76 50 58 77 87 76 38 83 78 85 85 97 95 39 83 10 78 91 93 95 94 90 85 99 39 39 93 82 80 109 79 76 74 89 73 82 102

The Effective Use of Protein Kinase Inhibitors

102 101 76 50 58 77 87 76 38 83 78 85 85 97 95 39 83 10 78 91 93 95 94 90 85 99 39 39 93 82 80 109 79 76 74 89 73 82 102

Poster: Purification with Millipore MultiScreen 384SEQ Plates on Beckman-Coulter’s Biomek FX for High Quality Direct Sequencing in High-Throughput Genomics

resequencing necessary il12a_7-A zq r1 38.97 383.58 76% il12a_7-A zq r1 40.55 400.58 76% il12a_7-A zq r1 40.03 403.13 75% il12a_7-A zq r2 42.17 436.31 76% il12a_7-A zq r2 34.63 293.07 68% no resequencing

Data Sheet - F8551

mature 76 amino acid variant of the chemokine domain of mature rat fractalkine (amino acid residues 25 to 100, QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKR AIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTR NG).1 Rat fractalkine

Data Sheet - SAB4200862

concentration by titration test. References 1. Lamas A., et al., Microbiol Res., 206: 60-73 (2018). 2. Dos Santos AMP., et al., Curr Microbiol., 76: 762-773 (2019). 3. Yang L. and Li

Data Sheet - SAB4200868

Y., et al. J Immunol., 184, 2671–76 (2010). 7. Castro MS., et al., J Appl Microbiol.,121, 1117–29 (2016). 8. Zhou Y., et al., Medicine (Baltimore), 95, e5019 (2016). 9. Knoop KA.

Data Sheet - SRP5129

Data Sheet - SRP5221

Avoid repeated handling and multiple freeze/thaw cycles. Figure 1. SDS-PAGE Gel of Typical Lot 70–95% (densitometry) References 1. Jensen, L.R. et al., Mutations in the JARID1C gene, which is

Data Sheet - SRP5148

.1 mM EDTA, 0.25 mM DTT, 0.1 mM PMSF, and 25% glycerol. Molecular mass: ∼76 kDa Purity: 70–95% (SDS-PAGE, see Figure 1) Precautions and Disclaimer This product is for R&D use only, not for drug

Aldrich Polymer Products Application - Transitions

ether -43 86 4-Fluorostyrene 95 Formaldehyde -82 181 Hexadecyl acrylate 35 Hexadecyl methacrylate 15 Hexyl acrylate 57 Hexyl methacrylate -5 2-Hydropropyl methacrylate 76 Hydroquinone-alt-epichlorohydrin

(C9422) - Enzyme Assay

REFERENCE: Worthington, C.E. (1988) Worthington Enzyme Manual, pp. 76-79, Worthington Biochemical Corporation, Freehold, NJ NOTES: 1. This assay is based on the cited reference. 2. Where Sigma Product

(C0898) - Enzyme Assay

(C8546) - Enzyme Assay

Data Sheet - F7751

Endocrinology 134(3), 1401 (1994). CONTROLLED SUBSTANCE - DEA LICENSE REQUIRED (III) Rev. 1/95

User Guide - SAE0176

221–233 (2007). 5. Hannocks, M.J. et al., Matrix. Biol. 75–76: 102-113 (2019). 6. Medeiros. N.I. et al. Parasite Immunol. 39(8): 1-8 (2017). 7. Radosinska, J. et al., Panminerva Med. 59(3):

Monoclonal Anti-Bcl-2 antibody produced in mouse (B9804)

c mice immunized with a synthetic peptide corresponding to amino acids 61-76 of the mouse Bcl-2 sequence conjugated to KLH.1 The isotype is determined by a double diffusion immunoassay using Mouse

Data Sheet - F2792

stain 1 x 10 , cells a fluorescence intensity is is constitutively expressed on most peripheral blood T observed similar to that obtained with saturating monoclonal lymphocytes (approximately 95% of CD4

RABBIT ANTI-ARGININE VASOPRESSIN RECEPTOR (AVPR-V2) AFFINITY PURIFIED POLYCLONAL ANTIBODY

1.0 μg/mL using 1 μg/mL of control peptide to coat plate. Optimal working dilutions must be determined by the end user. SPECIES REACTIVITY: Rat. The immunogen peptide has 95% homology with

Product Information - 128708

This product is soluble in 95% ethanol (50 mg/ml), yielding a clear faint yellow solution. Heat may be required to get it to dissolve at that concentration. References 1. The Merck Index, 11th ed.

Data Sheet - I2659

we recommend determining optimal working dilutions by titration. References 1. Lee, R.T., et al., Cir. Res., 76, 209 (1995). 2. Chan, B.M., et al., Cell, 68, 1051 (1992). 3. Bergelson, J.M., et

Data Sheet - A5156

NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm

Data Sheet - A4262

NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm

Data Sheet - A1410

NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm

Actinomycin D (A9415)

NUMBER: 50-76-0 Synonyms: Dactinomycin; Actinomycin IV; Actinomycin C1 Molecular formula: C62H86N12O16 Molecular weight: 1255.42 Melting point: decomposes at 241.5-243 °C 1 E1% (244nm

Product Information Sheet - SAE0171

. Curr. Heart Fail. Rep., 11(1): 58–63 (2014). 3. Verdecchia, P. et al., The pivotal link between ACE2 deficiency and SARS-CoV-2 infection. Eur. J. Intern. Med., 76: 14-20 (2020). 4. Hoffmann

Data Sheet - 31404

and inhibit initial adsorption to susceptible cells. 25 References: 1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954). 2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568 (1955).

c-Jun N-Terminal Kinase from rat muscle (C3108)

stimulated by UV light and Ha-Ras that binds and phosphorylates the c-Jun activation domain. Cell, 76, 1025-1037 (1994). 7. Kyriakis, J.M., et al., The stress-activated protein kinase subfamily of

Product Information Sheet - T1647

Number: 76-05-1 pKa: 0.3; 1 0.23 (water at 25 °C)2; 0.50 (water at 25 °C)3 Melting Point: -15.4 °C 1 Boiling Point: 72.4 °C;1 70.5-72 °C 2 Density: 1.489 g/ml (20 C)4; 1.535 g/ml (20

Amicon® Ultra-4 Centrifugal Filter Devices User Guide

α-Chymotrypsinogen (1 mg/mL) 25,000 3K > 95 > 95 40 Cytochrome c (0.25 mg/mL) 12,400 > 95 > 95 40 Vitamin B-12 (0.2 mg/mL) 1,350 1 mg/mL) 25,000 10K > 95 > 95 15 Cytochrome

Data Sheet - 31395

and inhibit initial adsorption to susceptible cells. 25 References: 1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954). 2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568 (1955).

1/12