biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... DNAJB11(51726)
General description
DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). It contains the J domain, which is a highly conserved region made of 75 amino acids. It also shares certain domains with other HSP40 chaperones. These domains include a C-terminal domain, a glycine/phenylalanine-rich putative linker region and a cystine-rich domain. DNAJB11 is expressed ubiquitously, and has the highest expression in secretory tissues.
Immunogen
DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-DNAJB11 antibody is suitable for immunoprecipitation.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a component of unassembled immunoglobulin (Ig) heavy chain: BiP (binding immunoglobulin protein) complex, where it acts as a co-factor for BiP, and helps in folding and assembly of proteins. It plays a major role in mammalian cell resistance to vero toxin. It is also involved in ER (endoplasmic reticulum) stress tolerance. It is secreted in the extracellular space, where it binds to mis-folded proteins and prevents their aggregation. It also reduces the toxicity of disease-related prion protein. DNAJB11 is involved in the intoxication pathway of cholera toxin.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71693
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
存储类别
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
法规信息
新产品
此项目有
Wen-Li Lu et al.
Evidence-based complementary and alternative medicine : eCAM, 2014, 192749-192749 (2014-11-13)
Akebia Fructus has long been used for hepatocellular carcinoma (HCC) in China, while the molecular mechanism remains obscure. Our recent work found that Akebia trifoliate (Thunb.) Koidz seed extract (ATSE) suppressed proliferation and induced endoplasmic reticulum (ER) stress in SMMC-7721.
M Yu et al.
The Journal of biological chemistry, 275(32), 24984-24992 (2000-05-29)
Hsp40 co-chaperones, characterized by the presence of a highly conserved J domain, are involved in nearly all aspects of protein synthesis, folding, and secretion. Within the lumen of the endoplasmic reticulum, these chaperones are also involved in reverse translocation and
Joseph C Genereux et al.
The EMBO journal, 34(1), 4-19 (2014-11-02)
The Unfolded Protein Response (UPR) indirectly regulates extracellular proteostasis through transcriptional remodeling of endoplasmic reticulum (ER) proteostasis pathways. This remodeling attenuates secretion of misfolded, aggregation-prone proteins during ER stress. Through these activities, the UPR has a critical role in preventing
全球贸易项目编号
| 货号 | GTIN |
|---|---|
| HPA017051-100UL | 04061835681631 |