115 kDa

Gab1 is a 115 kDa multiple docking protein that plays an essential role in cellular growth, transformation and apoptosis. Gab1 can be phosphorylated by multiple receptor tyrosine kinase (RTKs), including: insulin receptor (IR), platelet derived growth factor receptor beta] (PDGFR-β]), hepatocyte growth factor/scatter factor receptor (HGFR/SFR or c Met), and epidermal growth factor receptor (EGF), as well as in response to cell cell adhesion. Gab1 is tyrosine phosphorylated on at least 16 sites, some of which serve as binding sites for phosphoatidylinositol 3 kinase (PI3K), Grb2, PLC gamma 1, Nck, and SHP2. Phosphorylation of Gab1 on tyrosines 627 and 659 is critical for its binding to SHP2, and for activation of the ERK/MAPK pathway in response to EGF.

31 residue peptide sequence corresponding to C-terminal residues 664-694 of Gab1 (CQKTLALKSTREAWTDGRQSTESETPAKSVK).

Epitope: C-terminus

Anti-Gab1 Antibody, CT detects level of Gab1 & has been published & validated for use in IC, IH(P), IP & WB.

Immunoprecipitation:
4 μg of this lot immunoprecipitated Gab1 from 500 μg of a human A431 carcinoma cell RIPA lysate.

Immunocytochemistry:
10 μg/mL of a previous lot showed positive immunostaining for Gab1 in A431 cells fixed with 4% paraformaldehyde.

Research Category
Signaling

Research Sub Category
MAP Kinases

Reactivity with other species has not been confirmed.

Specific for Gab1. No other known protein shares more than 10 amino acids with the immunizing sequence.

Affinity purified

Affinity purified IgG in buffer containing 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen solution.

Stable for 1 year at -20ºC from date of receipt.
Handling Recommendations: Upon receipt, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance. Note: Variability in freezer temperatures below -20°C may cause glycerol containing solutions to become frozen during storage.

Control
Non-stimulated A431 carcinoma cell lysate or NIH/3T3 cytoplasmic lysate.

Routinely evaluated by Western Blot on RIPA lysates from human A431 carcinoma cells.

Western Blot Analysis:
0.5-2 μg/mL of this lot detected Gab1 in RIPA lysates from human A431 carcinoma cells.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.