Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3

Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.

MAB2291 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3B.

Epitope: cytoplasmic domain

Synthetic peptide: CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK

Research Category
Cell Structure

Research Sub Category
Integrins

This Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3 is validated for use in WB, IC, IH for the detection of Integrin α3.

Western Blotting

Immunocytochemistry

Immunohistochemistry

Optimal working dilutions must be determined by the end user.

Anti-Integrin alpha 3B recognizes the cytoplasmic domain of integrin alpha 3B. Integrin alpha 3B is present in the microvascular structures in brain and heart.

SPECIES REACTIVITIES:

Although untested, a broad species reactivity is expected due to the conserved nature of the epitope.

Format: Purified

Purified. Liquid in PBS containing 0.1% sodium azide.

Store at 2-8°C, or in small aliquots at -20°C.

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.