Anti-MyBL2 antibody produced in rabbit

Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 (MyBL2), a MYB family member, is a transcription factor involved in the regulation of cyclin A/cyclin-dependent kinase 2-dependent cell cycle progression. MyBL2 is implicated in the development and maintenance of the stem cell phenotype with a role in the proliferation and differentiation of several cell types. MYBL2 plays a subtle but key role in linking specific aspects of cell-cycle progression with generation of signals for differentiation. MYBL2 is implicated in human malignancies such as hepatocellular carcinoma (HCC).

Rabbit polyclonal anti-MyBL2 antibody reacts with canine, rat, zebrafish, bovine, chicken, and human Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 transcription factors.

The immunogen for anti-MYBL2 antibody: synthetic peptide derected towards the N terminal of human MYBL2

Anti-MyBL2 antibody produced in rabbit is suitable for western blotting at a working concentration of 0.5-1.0 μg/ml. A concentration of 4-8 μg/ml may be used for immunohistochemistry of paraffin-embedded tissue sections.

Rabbit polyclonal anti-MyBL2 antibody is used to tag Myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of myb-related protein B/v-Myb myeloblastosis viral oncogene homolog (avian)-like 2 in cell-cycle progression and differentiation.

Lyophilized from PBS buffer with 2% sucrose

Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.