Anti-RBM10 (AB1) antibody produced in rabbit

The RNA Binding Motif 10 (RBM10) is similar to RBM5 and functions as a modulator of apoptosis. RBM10 can also act as an RNA binding protein and regulate the co-transcriptional modification of pre-mRNA.
Rabbit Anti-RBM10 (AB1) antibody recognizes canine, mouse, rat, and human RBM10.

Synthetic peptide directed towards the N terminal region of human RBM10

Rabbit Anti-RBM10 (AB1) antibody can be used for western blot (1.4μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissues) applications.

RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3′ end lies within 20 kb upstream of UBE1.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSETQRRRRRRHRH

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.