Anti-NFYA antibody produced in rabbit

NFYA is a nuclear transcription factor that forms a regulatory subunit of the trimeric complex of NF-Y that associates with CCAAT motifs in cell cycle progression genes. Hence, this gene has been implicated in cell proliferation. Furthermore, NFYA can also facilitate the self-renewal of hematopoietic stem cells (HSCs).
Rabbit Anti-NFYA antibody recognizes canine, chicken, human, mouse, rat, and bovine NFYA.

Synthetic peptide directed towards the C terminal region of human NFYA

Rabbit Anti-NFYA antibody can be used for immunohistochemistry (4-8μg/ml using paraffin-embedded tissues) and western blot (5-8μg/ml) applications.

NFYA is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: YLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.