Anti-RIPK3 antibody produced in rabbit

Rabbit polyclonal anti-RIPK3 antibody reacts with mouse, bovine, canine, and human receptor-interacting serine-threonine kinase 3 kinases.

Receptor-interacting serine-threonine kinase 3 (RIPK3, RIP3β, RIP3gamma) is a key signaling molecule in the programmed necrosis (necroptosis) pathway. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and it is involved in the regulation of (tumor necrosis factor (TNF)-related apoptosis inducing ligand) TRAIL-induced apoptosis.

The immunogen for anti-RIPK3 antibody: synthetic peptide derected towards the N terminal of human RIPK3

Anti-RIPK3 antibody has been used for the studying the role of RIPK3 in necroptosis. The antibody can be used for western blot (1.25μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) applications.

Rabbit polyclonal anti-RIPK3 antibody is used to tag receptor-interacting serine-threonine kinase 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of receptor-interacting serine-threonine kinase 3 apoptosis pathways.

Lyophilized from PBS buffer with 2% sucrose

Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.