Anti-RFP2 (AB2) antibody produced in rabbit

RFP2 (or TRIM13) codes for a protein that has zinc-binding domains along with RING, B-box type 1 and 2, and coiled-coil regions. TRIM13 is known to function as an ERAD E3 ubiquitin ligase.
Rabbit Anti-RFP2 antibody recognizes human, mouse, rat, bovine, and canine RFP2.

Synthetic peptide directed towards the middle region of human RFP2

Rabbit Anti-RFP2 antibody can be used for western blot applications at a concentration of 2.5 μg/ml.

The protein encoded by RFP2 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. RFP2 is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQR

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.