Anti-PCGF3 (AB1) antibody produced in rabbit

PCGF3 codes for a C3HC4 type RING finger protein that may regulate protein-protein interactions.
Rabbit Anti-PCGF3 recognizes bovine, human, mouse, and rat PCGF3.

Synthetic peptide directed towards the middle region of human PCGF3

Rabbit Anti-PCGF3 (AB1) antibody can be used for western blot applications at a concentration of 0.125 μg/ml.

PCGF3 encodes a protein that contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined.

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.