Anti-BRD4 antibody produced in rabbit

Bromodomain containing 4 (Brd4), a member of the BET family of proteins, has been shown to play important roles in cellular growth control, cell cycle progression, and cancer development. Brd4 is a chromatin adapter molecule crucial for transmitting epigenetic information by acting as a histone acetylation-dependent gene bookmark and accelerating post-mitotic transcriptional reactivation. Bdr4 localizes to chromosomes during mitosis and during interphase it interacts with P-TEFb to function as a global transcriptional coactivator. BRD4, has been identified recently as a therapeutic target in acute myeloid leukemia, multiple myeloma, Burkitt′s lymphoma, NUT midline carcinoma, colon cancer, and inflammatory disease; its loss is a prognostic signature for metastatic breast cancer. BRD4 also contributes to regulation of both cell cycle and transcription of oncogenes, HIV, and human papilloma virus (HPV).

The immunogen for anti-BRD4 antibody: synthetic peptide derected towards the C terminal of human BRD4

Anti-Bromodomain containing 4 polyclonal antibody is used to tag Brd4 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of Brd4 in cellular growth control, cell cycle progression, and cancer development.

Anti-Bromodomain containing 4 polyclonal antibody reacts with human, mouse, rat, bovine, and canine Brd4 proteins.

Lyophilized from PBS buffer with 2% sucrose

Synthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.