Anti-RBM45 antibody produced in rabbit

RNA binding motif protein 45 (RBM45, DRB1) is a member of the neural RNA recognition motif (RRM)-type neural RNA-binding protein involved in essential roles in neural development. DRB1 possesses a binding preference for poly(C)RNA.

The immunogen for anti-RBM45 antibody: synthetic peptide derected towards the middle region of human RBM45

Anti-RBM45 polyclonal antibody is used to tag RNA binding motif protein 45 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein 45 in poly(C)RNA binding and neural development.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

Anti-RBM45 polyclonal antibody reacts with rat, bovine, human, mouse, rat, and human RNA binding motif protein 45 proteins.

Lyophilized from PBS buffer with 2% sucrose

Synthetic peptide located within the following region: MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.