Anti-MBOAT1 antibody produced in rabbit

MBOAT1 codes for membrane bound O-acyltransferase domain containing 1 protein. It functions as an enzyme that facilitates the transfer of oleoyl-CoA to hydroxyl groups of membrane proteins. A de novo translocation in MBOAT1 has been linked to brachydactyly-syndactyly syndrome.
Rabbit Anti-MBOAT1 antibody recognizes human, mouse, and rat MBOAT1.

Synthetic peptide directed towards the N terminal region of human MBOAT1

Rabbit Anti-MBOAT1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-304 AL158198.14 79926-80229 c 305-450 AL158198.14 20414-20559 c 451-528 AL158198.14 18975-19052 c 529-624 AL158198.14 12010-12105 c 625-680 AL355139.10 10796-10851 c 681-735 AL355139.10 8351-8405 c 736-919 AL355139.10 6169-6352 c 920-1112 AL355139.10 4060-4252 c 1113-1216 AL008627.1 1909-2012 1217-1281 AL008627.1 5097-5161 1282-1414 AL008627.1 7441-7573 1415-1566 AL008627.1 10700-10851 1567-3275 AL008627.1 18037-19745

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Synthetic peptide located within the following region: AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.