Monoclonal Anti-EREG antibody produced in mouse

Epiregulin is a member of the epidermal growth factor family. Epiregulin can function as a ligand of EGFR (epidermal growth factor receptor), as well as a ligand of most members of the ERBB (v-erb-b2 oncogene homolog) family of tyrosine-kinase receptors. (provided by RefSeq)

EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE

The encoded protein epiregulin upon binding to the epidermal growth factor receptor causes dimerization and autophosphorylation of the receptor at its kinase domain. This event activates a number of intracellular signalling pathways. Epiregulin is known to induce progression of cancer especially in colon cancer cells. Overexpression of the gene EREG (epiregulin) is observed in human colon, breast and ovarian cancers. Upregulation and activation of epiregulin is known to elevate the phosphorylation of its receptor in glioblastoma thereby, promoting sphere formation, colony formation and tumor formation.

Solution in phosphate buffered saline, pH 7.4

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.