Anti-ZNF23 antibody produced in mouse

The gene ZNF23 (zinc finger protein 23) is mapped to human chromosome 16q22, a region associated with frequent alterations in acute myeloid leukemia. It belongs to the family of KRAB–ZFPs (Krupple-associated box-containing zinc-finger proteins), a large family of transcription factors. These proteins contain a KRAB domain at the N-terminal. The C-terminal consists of 16 tandem C₂H₂ class zinc fingers. The protein is ubiquitously expressed and the levels are greatly decreased or lost in cases of human cancer. The gene spans a length of 3271 nucleotides that encodes a protein of 643 amino acids.

ZNF23 (NP_666016.1, 1 a.a. ~ 643 a.a) full-length human protein.

Sequence
MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS

The gene ZNF23 (zinc finger protein 23) encodes a nuclear protein that is involved in the inhibition of cell cycle progression. Ectopic expression of this protein is associated with increased p27kip-1 expression, growth inhibition and cell cycle arrest in G1 phase. The gene functions as a tumor suppressor, as its down regulation has been associated with carcinogenesis.

Solution in phosphate buffered saline, pH 7.4