Monoclonal Anti-RAD51C antibody produced in mouse

RAD51 paralog C (RAD51C) is a tumor suppressor gene. It belongs to the RAD51-like gene family and the gene encoding it is localized on human chromosome 17q23.

RAD51C (AAH00667.1, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL

RAD51 paralog C (RAD51C) aids in the recruitment of the enzyme RAD51 to DNA break sites. It may be involved in modulating its translocation from the cytoplasm to the nucleus. RAD51C has a role in genomic stability and homologous recombination repair. It has been associated with breast and ovarian cancer. Mutations in the gene encoding RAD51C have been linked to Fanconi anemia.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.