Monoclonal Anti-WARS antibody produced in mouse

Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) or IFP53 is the cytoplasmic form of tryptophanyl-tRNA synthetase. It is induced by interferons and the gene encoding it is localized on human chromosome 14q32.31.

WARS (NP_004175, 50 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
YKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDA

Tryptophanyl-tRNA synthetase, cytoplasmic (WARS) is involved in the tryptophan aminoacylation of tRNAtrp. Mutations in the gene encoding it have been associated with distal hereditary motor neuropathy.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.