Monoclonal Anti-SLC6A5 antibody produced in mouse

SLC6A5 (solute carrier 6A5) gene codes for the neuronal GlyT2 glycine transporter. GlyT2 is a member of the SLC6 solute carrier family of neurotransmitter sodium symporters. This gene is located on human chromosome 11p15.

SLC6A5 (NP_004202, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGEIR

SLC6A5 (solute carrier 6A5) is a neurotransmitter transporter, which helps to maintain a high presynaptic pool of glycine at glycinergic synapses. It participates in the removal and recycling of glycine from inhibitory synapses. Mutations in GlyT2 gene result in presynaptic hyperekplexia and startle disease.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.