Monoclonal Anti-PPIL4 antibody produced in mouse

Peptidylprolyl isomerase like 4 (PPIL4) is part of the cyclophilin family. This family has a role in protein folding, human immunodeficiency virus-1 (HIV-1) infection and immunosuppression by cyclosporin A. The gene encoding PPIL4 is localized on human chromosome 6q24-->q25. It possesses a PPIase motif, a lysine-rich domain, a RNA recognition motif and two bipartite nuclear targeting sequences. PPIL4 is expressed in the kidneys and other tissues.

PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY

Peptidylprolyl isomerase like 4 (PPIL4) may have a role in the immune system. Polymorphisms in the PPIL4 gene may enhance inflammation during rheumatoid arthritis.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.